KEGG   Mus musculus (mouse): 21355
Entry
21355             CDS       T01002                                 

Gene name
Tap2, ABC18, AI462429, APT2, Abcb3, Ham-2, Ham2, MTP2, PSF2, RING11, Tap-2, Y1, jas
Definition
(RefSeq) transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04145  Phagosome
mmu04612  Antigen processing and presentation
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    21355 (Tap2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21355 (Tap2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    21355 (Tap2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    21355 (Tap2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21355 (Tap2)
   05168 Herpes simplex virus 1 infection
    21355 (Tap2)
   05163 Human cytomegalovirus infection
    21355 (Tap2)
   05169 Epstein-Barr virus infection
    21355 (Tap2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    21355 (Tap2)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    21355 (Tap2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_29 AAA_30 AAA_16 AAA_21 AAA_23 AAA_15 AAA_25 AAA_33 AAA_18 Zeta_toxin SRP54
Other DBs
NCBI-GeneID: 21355
NCBI-ProteinID: NP_035660
MGI: 98484
Ensembl: ENSMUSG00000024339
Vega: OTTMUSG00000026436
UniProt: P36371 Q792S7
Position
17 B1; 17 17.98 cM
AA seq 702 aa
MALSYLRPWVSLLLADMALLGLLQGSLGNLLPQGLPGLWIEGTLRLGVLWGLLKVGELLG
LVGTLLPLLCLATPLFFSLRALVGGTASTSVVRVASASWGWLLAGYGAVALSWAVWAVLS
PAGVQEKEPGQENRTLMKRLLKLSRPDLPFLIAAFFFLVVAVWGETLIPRYSGRVIDILG
GDFDPDAFASAIFFMCLFSVGSSFSAGCRGGSFLFTMSRINLRIREQLFSSLLRQDLGFF
QETKTGELNSRLSSDTSLMSRWLPFNANILLRSLVKVVGLYFFMLQVSPRLTFLSLLDLP
LTIAAEKVYNPRHQAVLKEIQDAVAKAGQVVREAVGGLQTVRSFGAEEQEVSHYKEALER
CRQLWWRRDLEKDVYLVIRRVMALGMQVLILNCGVQQILAGEVTRGGLLSFLLYQEEVGQ
YVRNLVYMYGDMLSNVGAAEKVFSYLDRKPNLPQPGILAPPWLEGRVEFQDVSFSYPRRP
EKPVLQGLTFTLHPGTVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGEPLTEYDHHY
LHRQVVLVGQEPVLFSGSVKDNIAYGLRDCEDAQVMAAAQAACADDFIGEMTNGINTEIG
EKGGQLAVGQKQRLAIARALVRNPRVLILDEATSALDAQCEQALQNWRSQGDRTMLVIAH
RLHTVQNADQVLVLKQGRLVEHDQLRDGQDVYAHLVQQRLEA
NT seq 2109 nt   +upstreamnt  +downstreamnt
atggcgctgtcctacctgaggccctgggtctctctgctgctggcggacatggctttactt
gggttgctacaaggatctctgggaaatctgcttccccaggggctgccaggactctggata
gagggcaccctgcgacttggagtgctgtggggactgctaaaagtgggagagctgctggga
cttgtggggacccttctgcccttgctctgccttgccactcccctgtttttctcgctaaga
gctctggtgggaggcaccgcgagcacctcagtagtccgagtggcttctgcctcttggggc
tggctgctggctggctatggggctgttgcgctgagctgggccgtgtgggctgtgctgagc
ccggctggagtccaggagaaggaaccaggccaggagaacagaacactgatgaagcggttg
ctgaagctgtccaggccggacctgcctttcctcatagctgccttcttcttccttgtggtg
gctgtgtggggggagacattaatccctcgctattcgggtcgtgtaattgacatcctggga
ggtgatttcgaccccgacgcctttgcaagcgccatctttttcatgtgcctgttctctgtt
gggagctccttctctgcaggctgtagaggaggctccttcctcttcaccatgtccaggatc
aacctgcggatacgagagcagcttttctcatctttgttgcgccaagaccttggattcttc
caggagaccaagacaggggagctgaactcgaggctgagctctgacacctctctgatgagc
cgctggctccctttcaatgccaatatcctgctgcggagcctggtgaaggtggtggggctc
tacttcttcatgctccaggtatcgccccgactcaccttcctctccctgctggacctgccc
ctcacgatagcagctgagaaggtgtacaacccccgccatcaggcggtgctaaaggagatc
caggatgcagtggccaaggcggggcaggtggtgcgcgaggcggtaggagggctgcagact
gtgcgaagctttggggccgaggagcaggaagtcagccactacaaggaggccctggagcga
tgtagacagctgtggtggcgccgagacctggaaaaagacgtgtatctagtcatacggagg
gtgatggccttgggcatgcaggtgctgattctgaactgcggcgtgcagcagattctggct
ggagaggtcacccggggtggcctgctctccttcctgctgtaccaggaggaagtgggacaa
tatgtccggaacctggtttacatgtacggggatatgctgagcaacgtgggcgctgctgaa
aaggtgttttcctacctggaccgaaagccgaatctgccccagcctgggatcctggcccct
ccctggctggaggggcgcgtggaattccaagacgtctccttttcgtatcccaggcgcccc
gagaagcctgtgctccagggtctgacgttcaccctgcatcctggaacggtgacagcgttg
gtgggacccaatggatcagggaagagcaccgtggccgccctgctgcagaacctgtaccag
cccactgggggccagctgctgctggatggcgagcccctgaccgagtatgatcaccactac
ctgcaccgccaggtggttctggtggggcaggagcctgtgctgttctcgggttctgtcaag
gacaatattgcctatggcctgagggactgtgaggacgctcaagtgatggcagctgcccag
gcggcctgtgcagacgacttcataggggaaatgactaatggaataaacacagaaatcggg
gaaaaagggggccagttagctgtgggacagaagcaacgtctggccattgcccgggccctt
gtgcggaacccacgggtcctcatcctggatgaggctaccagcgccctggacgcccagtgt
gaacaggccctacagaactggagatcgcagggggacaggacgatgctggtgattgcccac
aggctgcacacggttcagaatgctgaccaagttctggtgctcaagcagggacgtctggtg
gagcatgaccagctcagggacggccaggatgtctacgcccacctggtacagcagcggctg
gaggcatga

DBGET integrated database retrieval system