KEGG   Mus musculus (mouse): 21356
Entry
21356             CDS       T01002                                 

Gene name
Tapbp, D17Wsu91, D17Wsu91e, TPN, t
Definition
(RefSeq) TAP binding protein
  KO
K08058  TAP binding protein (tapasin)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    21356 (Tapbp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21356 (Tapbp)
   05168 Herpes simplex virus 1 infection
    21356 (Tapbp)
   05163 Human cytomegalovirus infection
    21356 (Tapbp)
   05169 Epstein-Barr virus infection
    21356 (Tapbp)
SSDB
Motif
Pfam: C1-set Ig_3 ig Med5
Other DBs
NCBI-GeneID: 21356
NCBI-ProteinID: NP_033344
MGI: 1201689
Ensembl: ENSMUSG00000024308
Vega: OTTMUSG00000037070
UniProt: Q9R233 Q3U9A3 Q8C6N4 Q9D679
Position
17 B1; 17 17.98 cM
AA seq 465 aa
MKPLLLLVAVALGLATVVSVVSAGPEAIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPR
PDLDPKLYFKVDDPAGMLLAAFRRYPAGASAPHCEMSRFIPFPASAKWARSLSPEQNCPR
ALDGDWLLVSVSSTLFSLSSLLRPQPEPLREPVVITMATVVLTVLTHNPAPRVQLGKDAV
LDLRFAYAPSALEGSPSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGRMPPAQEKATA
FAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYLATVHLPYLQGQVSLELTVHKAPRVSLT
PAPVVWAAPGEAPPELLCLASHFFPAEGLEVKWELRGGPGGSSRKVEGKTWLSTIRHHSD
GSVSQSGHLQLPPVTAKQHGVHYVCRVYHSSLPASGRSADVTLEVAGFSGPSIEDGIGLF
LSAFLLLGLLKVLGWLAAYWTIPEVSKEKATAASLTIPRNSKKSQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaagcctctgctcctgctcgtcgctgtggcactgggcctagcgaccgtcgtctccgtc
gtctcggctggaccagaggcgatcgagtgctggttcgtggaggatgcaggtgggggtggc
ctgtctaagaaacctgccacactgctactgcgccatggacccaggggaccgccgccccgg
ccagatcttgacccaaagctatacttcaaggtggatgacccggcgggaatgctcctggcc
gccttcaggcggtaccccgcaggcgcctccgccccacactgcgagatgagccgcttcatc
ccgttccctgcctcggcgaagtgggctagaagtctgagtccggagcagaactgcccgcgg
gccctggacggggattggctgctggtcagcgtatccagcactctcttcagcctctccagc
ctgctgcgaccacagccggagcctctgcgggagcctgtcgtcatcaccatggcaacagtg
gtgctgaccgtcctcacccataaccctgcccctcgagtccagctgggaaaggatgcagtg
ctggacctgcgcttcgcctacgcaccctccgccctggaaggttctccctctctggacgca
ggccctcctccctttgggctggagtggcgacgccagcacaggggaaagggtcacctgctg
ttggctgccacccccgggctggccgggagaatgccaccagcccaggaaaaggctacggca
tttgcagcttgggatgacgatgagccctggggcccgtggactgggaatgggaccttctgg
cttccagccgtgaagccttctcaggagggtgtctacctggctacggtacacctgccctac
ctgcaaggacaggtctccctggagctgactgtgcacaaggcccccagagtgtctctaaca
ccagcacccgttgtgtgggctgccccaggagaggcacccccagaactgctctgtcttgca
tcccacttcttccctgcggagggtctggaggtcaagtgggagctcagaggcggcccagga
ggaagttctagaaaggttgaggggaagacgtggctctccaccatccgccaccattccgat
ggctctgtcagccagtctgggcacctgcagctacctccagtcactgccaagcagcatgga
gttcactatgtctgtcgggtgtaccactctagcctgccagcatcggggcgcagtgctgac
gtcaccctggaggtggcaggcttctcagggccctccatcgaggacggcatcggcctgttc
ctgtctgcttttctcctcctcggactcctcaaggtgctaggctggctggctgcctactgg
accattcctgaagtctcaaaggagaaggccacagctgccagcctgaccattcccaggaac
tcaaagaagtcacagtaa

DBGET integrated database retrieval system