KEGG   Mus musculus (mouse): 21356
Entry
21356             CDS       T01002                                 

Gene name
Tapbp, D17Wsu91e, TPN
Definition
(RefSeq) TAP binding protein
  KO
K08058  TAP binding protein (tapasin)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    21356 (Tapbp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21356 (Tapbp)
   05168 Herpes simplex virus 1 infection
    21356 (Tapbp)
   05163 Human cytomegalovirus infection
    21356 (Tapbp)
   05169 Epstein-Barr virus infection
    21356 (Tapbp)
SSDB
Motif
Pfam: C1-set Ig_3 ig Med5
Other DBs
NCBI-GeneID: 21356
NCBI-ProteinID: NP_033344
MGI: 1201689
Ensembl: ENSMUSG00000024308
Vega: OTTMUSG00000037070
UniProt: Q9R233 Q3U9A3 Q8C6N4 Q9D679
Position
17 B1; 17 17.98 cM
AA seq 465 aa
MKPLLLLVAVALGLATVVSVVSAGPEAIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPR
PDLDPKLYFKVDDPAGMLLAAFRRYPAGASAPHCEMSRFIPFPASAKWARSLSPEQNCPR
ALDGDWLLVSVSSTLFSLSSLLRPQPEPLREPVVITMATVVLTVLTHNPAPRVQLGKDAV
LDLRFAYAPSALEGSPSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGRMPPAQEKATA
FAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYLATVHLPYLQGQVSLELTVHKAPRVSLT
PAPVVWAAPGEAPPELLCLASHFFPAEGLEVKWELRGGPGGSSRKVEGKTWLSTIRHHSD
GSVSQSGHLQLPPVTAKQHGVHYVCRVYHSSLPASGRSADVTLEVAGFSGPSIEDGIGLF
LSAFLLLGLLKVLGWLAAYWTIPEVSKEKATAASLTIPRNSKKSQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaagcctctgctcctgctcgtcgctgtggcactgggcctagcgaccgtcgtctccgtc
gtctcggctggaccagaggcgatcgagtgctggttcgtggaggatgcaggtgggggtggc
ctgtctaagaaacctgccacactgctactgcgccatggacccaggggaccgccgccccgg
ccagatcttgacccaaagctatacttcaaggtggatgacccggcgggaatgctcctggcc
gccttcaggcggtaccccgcaggcgcctccgccccacactgcgagatgagccgcttcatc
ccgttccctgcctcggcgaagtgggctagaagtctgagtccggagcagaactgcccgcgg
gccctggacggggattggctgctggtcagcgtatccagcactctcttcagcctctccagc
ctgctgcgaccacagccggagcctctgcgggagcctgtcgtcatcaccatggcaacagtg
gtgctgaccgtcctcacccataaccctgcccctcgagtccagctgggaaaggatgcagtg
ctggacctgcgcttcgcctacgcaccctccgccctggaaggttctccctctctggacgca
ggccctcctccctttgggctggagtggcgacgccagcacaggggaaagggtcacctgctg
ttggctgccacccccgggctggccgggagaatgccaccagcccaggaaaaggctacggca
tttgcagcttgggatgacgatgagccctggggcccgtggactgggaatgggaccttctgg
cttccagccgtgaagccttctcaggagggtgtctacctggctacggtacacctgccctac
ctgcaaggacaggtctccctggagctgactgtgcacaaggcccccagagtgtctctaaca
ccagcacccgttgtgtgggctgccccaggagaggcacccccagaactgctctgtcttgca
tcccacttcttccctgcggagggtctggaggtcaagtgggagctcagaggcggcccagga
ggaagttctagaaaggttgaggggaagacgtggctctccaccatccgccaccattccgat
ggctctgtcagccagtctgggcacctgcagctacctccagtcactgccaagcagcatgga
gttcactatgtctgtcgggtgtaccactctagcctgccagcatcggggcgcagtgctgac
gtcaccctggaggtggcaggcttctcagggccctccatcgaggacggcatcggcctgttc
ctgtctgcttttctcctcctcggactcctcaaggtgctaggctggctggctgcctactgg
accattcctgaagtctcaaaggagaaggccacagctgccagcctgaccattcccaggaac
tcaaagaagtcacagtaa

DBGET integrated database retrieval system