KEGG   Mus musculus (house mouse): 21357
Entry
21357             CDS       T01002                                 
Symbol
Tarbp2, Prbp, TRBP
Name
(RefSeq) TARBP2, RISC loading complex RNA binding subunit
  KO
K18420  RISC-loading complex subunit TARBP2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    21357 (Tarbp2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    RISC loading complex
     21357 (Tarbp2)
SSDB
Motif
Pfam: dsrm DND1_DSRM Staufen_C
Other DBs
NCBI-GeneID: 21357
NCBI-ProteinID: NP_033345
MGI: 103027
Ensembl: ENSMUSG00000023051
UniProt: P97473 Q3UNH9
Position
15:102423327..102432111
AA seq 365 aa
MSEEDQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSLLDSSPPE
DTPVVAAEAAAPVPSAVLTRSPPMEMQPPVSPQQSECNPVGALQELVVQKGWRLPEYMVT
QESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPD
DDHFSIGVSSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSVGSLGALGSACCSVLSEL
SEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCYGSATTREAARGDAAHRALQYLRI
MAGSK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagtgaagaggatcagggctccggcactactacaggctgcgggctgcccagcatagag
caaatgctggccgccaacccgggcaagaccccgatcagccttcttcaggagtatgggacc
agaataggaaagacgcccgtgtacgaccttctcaaagccgagggccaagcccatcaacct
aatttcacctttcgggtcaccgttggcgacaccagctgcactggtcagggccccagcaag
aaggcagccaagcacaaggcagctgaggtggccctcaaacacctcaaaggggggagcatg
ctggaaccagccctggaggacagcagttctttttctctcctagactcttcaccgcctgag
gacactcctgtcgttgctgcagaagctgctgcccctgttccatctgctgtactaaccagg
agccctcccatggagatgcagccccctgtctctcctcagcagtctgagtgcaaccccgtc
ggtgctctgcaggagctggtggtgcaaaaaggctggcgtttgccagagtacatggtgacc
caagagtctgggcctgctcaccgcaaagagttcaccatgacttgccgggtggagcgtttc
attgagattggcagtggcacttccaaaaagctggcaaagcgtaacgcagcagctaagatg
ctccttcgagtgcacactgtacctctggatgcccgggatggcaatgaggcagagcctgat
gacgatcatttttccattggcgtgagctcccgcctggatggactgaggaatcgtgggcca
ggctgcacctgggattccttgcggaattctgtgggagaaaagatcctatcccttcgcagt
tgctccgtgggctctctaggggctctgggctctgcctgctgcagtgtcctcagtgagctc
tctgaggagcaggctttccatgtcagctatctggatattgaggaactgagcctgagtggg
ctctgccagtgcctagtggaactgtccacccagccagccactgtgtgttatggttctgca
accaccagggaggcagcccgaggtgatgctgctcaccgcgccctacagtacctcaggatc
atggcgggtagcaagtag

DBGET integrated database retrieval system