KEGG   Mus musculus (mouse): 213575
Entry
213575            CDS       T01002                                 

Symbol
Dync2li1, 4933404O11Rik, CGI-6, CGI-60, D2l, D2lic, LI, LIC3, mD2L, mD2LIC
Name
(RefSeq) dynein cytoplasmic 2 light intermediate chain 1
  KO
K10417  dynein cytoplasmic 2 light intermediate chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    213575 (Dync2li1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    213575 (Dync2li1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    213575 (Dync2li1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    213575 (Dync2li1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      213575 (Dync2li1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     213575 (Dync2li1)
SSDB
Motif
Pfam: DLIC Roc
Other DBs
NCBI-GeneID: 213575
NCBI-ProteinID: NP_758460
MGI: 1913996
Ensembl: ENSMUSG00000024253
UniProt: Q8K0T2
Position
17; 17 E4
AA seq 351 aa
MPSETLWEIAKAEVEKRRSHGSEGDGAEIGEKSVFFIGSKNGGKTTIILRCLDRDESAKP
TLALEYTYGRKTKGHNTPKDIAHFWELGGGTSLLDLISIPITVDTLRTFSIVLVLDLSKP
NDLWSTMENLLQATKSHVDKVIMKLGKTSSKASAEMRQRMWSVVQKDHPDRELIDPFPIP
LVIIGSKYDIFQDFDPEKRKVICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFG
IDKSKSICVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQAHSPMELWKKVYDKLFPPK
STGTLKAVQDPARDPQYAESEVDEMRVQKDQELEHYKRSSSKTWKQIELDS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcccagtgaaactctctgggaaatcgcaaaagctgaggtagagaaacggagaagtcat
gggagcgaaggggacggagctgaaatcggagaaaaatctgttttcttcattggcagtaaa
aacgggggaaagacaaccattatcctaaggtgtcttgacagggatgagtcagcaaagccg
accttagcgttggagtacacgtacggaaggaagaccaaggggcacaacacgccaaaagac
attgctcacttttgggaactgggtggaggaacctccttgctggacttaatcagcatacca
atcacagtcgacaccttaaggacattttctattgttcttgttttggatctttccaaacct
aatgatctttggtcaaccatggaaaatctgttgcaagccacaaaaagccatgtagacaag
gtgataatgaagctgggcaagacaagctccaaggcttcggccgagatgcggcaacgaatg
tggagcgtggtgcagaaggaccatccggaccgggaattaattgacccatttccaatacct
ctggtcattattggaagtaaatatgatattttccaggattttgatcctgagaagagaaag
gtgatatgtaagaccctgcgctttgtggcacattactacggagcctcgctgatgtttacc
agcaagtcagaagctctgttactgaagatacgcggtgttatcaaccagttggcattcggt
attgataaaagcaaatcaatatgtgtggatcaaaataagccactgtttatcacagcagga
ctggattctttatgtcagatagggtctcctcctgttcctgacagtgacattggaaaactt
caggcccactcacctatggagctgtggaaaaaggtgtatgacaagctcttcccaccaaag
agtaccggcaccctgaaggcggtccaggacccagcccgagacccgcagtatgcagaaagc
gaagtcgatgagatgagggttcagaaggaccaggaactagaacactacaagagaagctcc
tctaagacctggaagcaaatcgagctggactcctga

DBGET integrated database retrieval system