KEGG   Mus musculus (mouse): 213649Help
Entry
213649            CDS       T01002                                 

Gene name
Arhgef19, 6030432F23, 6430573B13Rik, WGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 19
  KO
K20691  Rho guanine nucleotide exchange factor 19
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    213649 (Arhgef19)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    213649 (Arhgef19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 SH3_9 SH3_2 PH
Motif
Other DBs
NCBI-GeneID: 213649
NCBI-ProteinID: NP_766108
MGI: 1925912
Ensembl: ENSMUSG00000028919
Vega: OTTMUSG00000010201
UniProt: Q8BWA8
Position
4; 4 D3
AA seq 802 aa AA seqDB search
MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVDLFPIAPEELQAPGSR
WSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCPGAQPPTLVEPWSSQHM
QPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAAQEQALCALEPGPQELSG
NARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGSGAGAIREGKLPVRESRRA
ETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQDPSSATERRQSRFLLNSVLYQEYSD
VASARELRRQQREEEGPGDGAEGAEEGPGPPRANLSPSSSFRAQRSTRGSTFSLWQDIPD
VRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSVELSECLGTQDKQWL
FSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDVVLHHCPAFRRVYLPYVTNQAYQERTY
QRLLLENPKFPGILARLEESPVCQRLPLTSFLILPFQRVTRLKMLVENILKRTAPGSQDE
DMATKAFSALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELV
ELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHANMAELQVRDLSLKL
QGIPGHVFLLRLLHGQRARHQLLLRARTESEKQRWISALRPSSPQEDKEITCDGEDRPQV
QCVRTYKALQPDELTLEKTDILAVKTRTSDGWLEGVRLADGEKGWVPQAHVVEISSLSAR
LRNLREYKRVSNASSKLGDPPA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgggccacctgcaaccctccagcctcacttggctggaccacctggcaccgcc
cgtcgcccagtagctgtgtgccagcaggagagcctgtccttcgtggagctgcctccgagc
cgactgtgtgtggatctctttcccattgctccagaggagctgcaagctcccggtagccgc
tggtccctggcaacccctgcccctctccaaggactgttatggccgacgtccccaggaggc
ccagatacccatatcgcctccaccagtggaggaatgagacccggcagggctggcagctgg
cctcactgtcctggtgcccagcccccaactctggtggaaccgtggagttctcagcacatg
cagccccaacgcagggccagccacagtggctcagagaagtcagcctggcgcaagatgcag
gtgtatcataacgaagaggccaccggcaccgagacccctacgggccttctggagactggc
caggctgcgcaagagcaggctctgtgtgctctagagcccgggccccaggagctttctggg
aacgccagagggggccttgaggcaccggagcgaaggcgtttctcggcctcagagctgatg
actaggctgcattcctctctgcgcttggggcgcagcactgccaccagggttctgacctcg
ggctcaggtgctggagccatccgggaagggaaactgcccgtgagggaatcccgaagagcc
gagacaagggcggacagtgtgtcgcttccaggacccgtcgatctaaacgaggtccacggt
ggtctggtggaacccaggctggacacgcaagacaagccgactcaggatcccagcagcgcc
actgagaggcgccagtcccgcttcctccttaattctgtcctctaccaggagtacagcgac
gtggccagcgcgcgcgagttgcggcggcagcagcgtgaggaggagggccccggggacgga
gcggagggcgcggaggaggggcccgggccaccgcgcgccaacctctccccgagcagctct
ttccgcgcgcaacgctcgacgcggggctccaccttctcgctgtggcaggacatccccgac
gtgcgcggcagtggcgtcctggccacgctgagcctgcgcgactgcaagctgcaggaggcc
aaatttgagctgattacctcggaggcctcctacatccatagcctgtcggtggccgtgggt
cacttcttaggttccgtggagctgagcgagtgtctggggactcaggacaagcagtggcta
ttttcaaaactgcccgaggtcaagagcaccagtgagaggttccttcacgacctggagcag
cgtctagaggccgatgtgctgcgcttcagcgtgtgcgatgtggttctacaccattgcccc
gcattccgccgagtctacctgccttacgtcaccaaccaggcctaccaggagcgcacctac
cagcgcctgctcctagagaaccccaagttccccggcatcctggctcgcctagaggagtct
cctgtgtgccagcggctgcctctcacctccttcctcatcttaccgttccagagggttacc
cgcctcaagatgctggtagagaacattttgaagcggacagcaccgggctcccaagatgag
gacatggccaccaaggccttcagcgctctaaaggagctggtgcaggagtgcaacgcgagc
gtgcagtccatgaagcggacggaggaactaattcacctaagcaagaagatccattttgag
ggcaagatcttcccgctgatctcacaggcccgctggctggtccggcacggggagctggtg
gagttggcccccctgcccgccgcaccgccagccaaactgaagctgtccagcaaggccgtg
taccttcacctcttcaatgactgcctgctgctgtcccggaggaaggagctcgggaagttt
gccgtttttgtccatgccaacatggctgagctacaggttcgagacctcagcctgaagctc
cagggcatcccaggccatgtgttcctgctcaggctgctgcacgggcagcgcgccaggcac
cagctgctgctgagagcacggaccgaaagtgagaagcaacggtggatttcagccttgaga
ccatccagcccccaggaggacaaggagatcacatgtgatggggaagaccgaccccaggtc
cagtgtgtgaggacctacaaggccctgcagccagatgaactcaccttggagaagacagac
atcctggcagtgaagaccaggaccagcgatggctggctggagggcgtgcgcctggccgat
ggtgagaagggatgggtgcctcaggcccatgtggtggagatcagcagcctcagcgctcga
ctgcgcaacctcagagagtacaagagggtctccaacgccagcagcaagctgggggaccca
cctgcctga

DBGET integrated database retrieval system