KEGG   Mus musculus (house mouse): 21366
Entry
21366             CDS       T01002                                 
Symbol
Slc6a6, Taut
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, taurine), member 6
  KO
K05039  solute carrier family 6 (neurotransmitter transporter, taurine) member 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    21366 (Slc6a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   21366 (Slc6a6)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 21366
NCBI-ProteinID: NP_033346
MGI: 98488
Ensembl: ENSMUSG00000030096
UniProt: O35316 Q3UPI8
Position
6:91661031..91736044
AA seq 621 aa
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEADGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEVIIGQYTSEGGITCWEKICPLF
SGIGYASIVIVSLLNVYYIVILAWATYYLFHSFQKDLPWAHCNHSWNTPQCMEDTLRRNE
SHWVSLSTANFTSPVIEFWERNVLSLSSGIDNPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGEGIKFYLYPDISRLGDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAILCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPALCVGCFVFSLVKYVPLTYNKVYRYPD
WAIGLGWGLALSSMLCIPLVIVILLCRTEGPLRVRIKYLITPREPNRWAVEREGATPFHS
RVTLMNGALMKPSHVIVETMM
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggccacgaaggagaagctgcaatgtctgaaagacttccacaaagacatcctgaagcct
tctccagggaagagcccaggcacacggcctgaagatgaggcggacgggaagccccctcag
agggagaagtggtccagcaagatcgactttgtgctgtctgtggccggaggcttcgtgggt
ttgggcaacgtctggcgtttcccgtacctctgctacaaaaatggtggaggtgcgttcctc
ataccgtattttattttcctgtttgggagcggcctgcctgtgtttttcttggaggtcatc
ataggccagtacacatcagaagggggcatcacctgctgggagaagatctgtcctttgttc
tctggcattggctacgcatccatcgtcattgtgtccctcctgaacgtgtactacatcgtc
atcctggcctgggccacatactacctattccactctttccagaaggatcttccctgggcc
cactgcaaccatagctggaacacaccacagtgcatggaggacaccctgcgtaggaacgag
agtcactgggtctcccttagcactgccaacttcacctcacccgtcatcgagttctgggag
cgcaatgtgctcagcctgtcctccggaatcgacaacccaggcagtctgaaatgggacctc
gcgctctgcctcctcttagtctggctcgtctgttttttctgcatctggaagggtgttcga
tccacaggcaaggttgtctacttcaccgctactttcccgtttgccatgcttctggtgctg
ctggtccgtggactgaccctgccaggtgctggtgaaggcatcaaattctacctgtaccct
gacatcagccgccttggggacccacaggtgtggatcgacgctggaactcagatattcttt
tcctacgcaatctgcctgggggccatgacctcactgggaagctataacaagtacaagtat
aactcgtacagggactgtatgctgctgggatgcctgaacagtggtaccagttttgtgtct
ggcttcgcaattttttccatcctgggcttcatggcacaagagcaaggggtggacattgct
gatgtggctgagtcaggtcctggcttggccttcattgcctacccaaaagctgtaaccatg
atgccgctgcccaccttttggtctattctgtttttcattatgctcctcttgcttggactg
gacagccagtttgttgaagtcgaaggacagatcacatccttggttgatctttacccgtcc
ttcctaaggaagggttatcgtcgggaaatcttcatagccatcttgtgtagcatcagctac
ctgctggggctgacgatggtgacggagggtggcatgtatgtgtttcaactctttgactac
tatgcagctagtggtgtatgccttttgtgggttgcattctttgaatgttttgttattgcc
tggatatatggcggtgataacttatatgacggtattgaggacatgattggctatcggcct
gggccctggatgaagtacagctgggctgtcatcactccagctctttgtgttggatgtttc
gtcttctcgcttgtcaagtatgtacccctgacctacaacaaagtgtaccggtacccggat
tgggcaattgggctgggctggggcctggccctttcctccatgctgtgtatccccttggtc
attgtcatcctcctctgccggacggagggaccgctccgcgtgagaatcaaatacctgata
acccccagggagcccaaccgctgggctgtggagcgtgaaggggccacaccctttcactcc
cgagtaaccctcatgaacggcgcactcatgaaacccagtcacgtcattgtggagaccatg
atgtga

DBGET integrated database retrieval system