KEGG   Mus musculus (mouse): 21367
Entry
21367             CDS       T01002                                 

Gene name
Cntn2, D130012K04Rik, TAG-1, TAG1, Tax
Definition
(RefSeq) contactin 2
  KO
K06760  contactin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    21367 (Cntn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    21367 (Cntn2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    21367 (Cntn2)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Contactins
   21367 (Cntn2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  21367 (Cntn2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_5 Ig_4 Ig_6 Pur_ac_phosph_N Izumo-Ig C2-set_2 C2-set Adeno_E3_CR1 Arylsulfotran_N
Other DBs
NCBI-GeneID: 21367
NCBI-ProteinID: NP_796103
MGI: 104518
Ensembl: ENSMUSG00000053024
Vega: OTTMUSG00000049393
UniProt: Q61330
Structure
PDB: 
5E7L

Position
1; 1 E4
AA seq 1040 aa
MGAPARKRASLLLLLLATMALVSSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVT
LACRARASPPATYRWKMNGTEMNLEPGSRHQLMGGNLVIMSPTKAQDAGVYQCLASNPVG
TVVSKEAVLRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIP
TDGRHFVSQTTGNLYIARTNASDLGNYSCLATSHLDFSTKSVFSKFAQLNLAAEDPRLFA
PSIKARFPPETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWGTAEPTLQIPSVSF
EDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPMV
RWLRNGEPLASQNRVEVLAGDLRFSKLNLEDSGMYQCVAENKHGTIYASAELAVQALAPD
FRQNPVRRLIPAARGGEISIPCQPRAAPKATILWSKGTEILGNSTRVTVTLDGTLIIRNI
SRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGDNLTLQCHASHDPTM
DLTFTWTLDDFPVDFDKPGGHYRRASVKETIGDLTILNAQLRHGGTYTCMAQTVVDGASK
EATVLVRGPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIAKYTLQARTPPSGKWKQVRT
NPVNIEGNAETAQVLGLMPWMDYEFRVSASNILGTGEPSGPSSRIRTKEAVPSVAPSGLS
GGGGAPGELTINWTPMSREYQNGDGFGYLLSFRRQGSSSWQTARVPGADTQYFVYSNDSI
HPYTPFEVKIRSYNRRGDGPESLTAIVYSAEEEPKVAPAKVWAKGSSSSEMNVSWEPVLQ
DMNGILLGYEIRYWKAGDKEAAADRVRTAGLDSSARVTGLYPNTKYHVTVRAYNRAGTGP
ASPSADAMTMKPPPRRPPGNISWTFSSSSLSLKWDPVVPLRNESTVTGYKMLYQNDLQPT
PMLHLTSKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVESSAVRPA
HPGPVFSCMVILMLAGCQRL
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgggagcaccggccaggaaaagggcaagcttgctgctgctgctgctggccacaatggct
ctggtctcctctccaggatggagtttttcccagggaaccccagctacctttggacccgtc
tttgaagagcaacctgttggcctgctattcccagaggagtctgcagaggatcaggtgaca
ctggcgtgccgtgcccgagctagccctccagccacctataggtggaagatgaacggcaca
gagatgaacctggaacctggttcccgtcaccagctgatggggggcaacctggtcatcatg
agtcccaccaaagcacaggatgctggtgtctaccagtgcctagcctctaacccagtaggc
actgtcgtcagcaaggaagctgtcctccgcttcggctttctacaggaattctccaaggag
gagagagaccccgtgaaaacccacgagggctggggggtgatgctgccctgtaacccacct
gcccactacccaggtttgtcctaccgctggctcctcaacgagttccccaacttcatccca
acggatgggcgtcacttcgtgtcccagaccacagggaacctgtacatcgcccgcaccaat
gcctcggacctgggcaactactcttgcctggctaccagccacctggacttctccaccaag
agcgtcttcagcaaattcgcgcagctcaacctggctgctgaagatcctcgactctttgct
cccagtatcaaagcccggttccccccagagacgtacgcactggttgggcagcaggtcacc
ctggagtgctttgcctttgggaaccctgttcccaggatcaagtggcgcaaagtggatggt
tccttgtcccctcagtggggcacagcagagcccaccctgcagatccccagtgttagcttt
gaagatgagggtacctatgaatgtgaggcagagaactccaagggccgtgacaccgtccag
ggacgcatcattgtgcaagctcagcctgagtggctaaaggtgatctcagacacagaagcc
gacattggttccaacttacgttggggctgtgctgcggcaggcaagcctcggcccatggtg
cgctggctgagaaacggggaacctctggcctcccagaaccgggtggaggtcttggctggg
gacctgcgattctctaagctgaacctggaggactccggcatgtaccagtgtgtggcagaa
aacaagcatggcaccatctatgccagtgctgagctggctgtacaagctctggccccagac
ttcaggcagaaccctgtgaggcggctgatccctgcagcccgagggggagagatcagtatc
ccgtgccagccccgtgcggctccaaaagctacaatactgtggagcaagggtactgagatt
ctggggaacagtaccagagtgactgtcactttggacggcaccttgattatcagaaacatc
agtcgatcggatgaaggcaaatatacctgctttgctgagaacttcatgggcaaagccaac
agtaccgggatcctgtctgtgcgagatgcaacgaagatcacgctagctccttcgagtgct
gacatcaatgtgggtgataacctgaccctacagtgccacgcctcgcatgaccccactatg
gacctcacgttcacctggaccctggatgacttccctgttgactttgataagcctggaggt
cactaccggagagccagtgtgaaggagaccattggggacctgactatcctgaatgcccag
ctacgccacggagggacatacacatgcatggcccagacagtggtggatggtgcatccaag
gaggccacagtcctggtccgaggtcccccaggtcctcctgggggtgtggtggtgagagac
attggagacactactgttcagcttagctggagtcgtggctttgacaatcacagccccatt
gccaagtacaccctgcaagcgcggactccaccctcagggaaatggaagcaggttcggacc
aatcctgtgaatatcgagggcaacgcggaaactgcccaggtgctggggctcatgccttgg
atggactatgagtttcgggtttcagctagcaacatcttgggcactggggagcccagcggc
ccctccagcagaatccgcactaaggaagcagtcccctctgtggcaccatctggactcagt
ggagggggaggagcccctggagagcttaccatcaactggactcccatgtcacgagagtac
cagaatggagacggcttcggctacctgctgtccttccgcaggcaaggcagctccagttgg
cagacggcccgggtgcccggcgctgatacccagtacttcgtctacagcaacgatagcatc
catccctacacaccctttgaggtcaagatccgaagctacaatcgccggggggatgggccc
gagagcctcactgccatcgtgtactcagcagaggaagagcccaaggtggcccctgccaag
gtctgggccaagggttcctcatcctcagagatgaacgtaagctgggagcctgtgctacaa
gacatgaacggcatcctcctgggatatgagattcgctactggaaagccggggacaaagaa
gctgccgctgaccgagtgaggacggcagggctagactccagtgcccgagtcaccggcctg
taccccaacaccaagtaccatgtaactgtgagggcctacaacagggctggcaccggacca
gctagcccttcagctgatgccatgaccatgaagcccccaccacggcgacctcctggcaac
atctcctggactttctcaagttccagcctcagccttaagtgggaccctgtggttcctctc
cgaaatgaatctacagtcactggctacaagatgttgtatcagaatgacctgcagccaact
cctatgctccacctcaccagcaagaactggatagaaataccagtacctgaagacattggt
cacgctctggtgcagattcgaaccacggggcctggaggggatgggataccagccgaagtc
cacattgtgagaaatggaggcaccagcatgatggtggagagctcagccgtccgccctgcc
catcctggcccggtgttctcctgcatggttatactgatgctcgccggatgccagaggctc
tga

DBGET integrated database retrieval system