KEGG   Mus musculus (mouse): 21371
Entry
21371             CDS       T01002                                 

Gene name
Tbca, Tbca1, Tbca13
Definition
(RefSeq) tubulin cofactor A
  KO
K17292  tubulin-specific chaperone A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21371 (Tbca)
   04147 Exosome [BR:mmu04147]
    21371 (Tbca)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     21371 (Tbca)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   21371 (Tbca)
SSDB
Motif
Pfam: TBCA
Other DBs
NCBI-GeneID: 21371
NCBI-ProteinID: NP_033347
MGI: 107549
Ensembl: ENSMUSG00000042043
UniProt: P48428 Q5I0U7
Position
13; 13 C3
AA seq 108 aa
MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQES
RMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSVKLEA
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccgatcctcgcgtgaggcagatcaagatcaagaccggagtagtgaggcgattggtc
aaagaaagagtgatgtacgaaaaagaagcaaagcagcaagaagaaaagattgaaaaaatg
aaggctgaagatggagagaactacgccattaagaagcaggcagagatcctgcaagagtcc
cggatgatgatcccagattgccagcgtcggttagaggctgcatatactgatcttcagcag
atattagaaagtgaaaaagacttggaagaagccgaggagtataaagaagcccgtgtagtg
ctggattccgtaaagctagaagcctga

DBGET integrated database retrieval system