KEGG   Mus musculus (mouse): 21390Help
Entry
21390             CDS       T01002                                 

Gene name
Tbxa2r, TP, TXA2-R
Definition
(RefSeq) thromboxane A2 receptor
  KO
K04264  thromboxane A2 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    21390 (Tbxa2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    21390 (Tbxa2r)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    21390 (Tbxa2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    21390 (Tbxa2r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Thromboxane
    21390 (Tbxa2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TMEM171
Motif
Other DBs
NCBI-GeneID: 21390
NCBI-ProteinID: NP_001264194
MGI: 98496
Ensembl: ENSMUSG00000034881
UniProt: P30987 Q5FW61
Position
10 C1; 10 39.72 cM
AA seq 341 aa AA seqDB search
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS
SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL
LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW
CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM
MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL
DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccaatggcacctcgctgggggcctgctttcgcccggtgaacatcacgctgcag
gagcgacgtgccatcgcgtcgccatggttcgctgcgtccttttgcgcgctgggcctgggg
tccaacctgctggcactgagtgtgctggctggggcgcggcccggcgcgggaccccgctcc
tccttcctcgctctgctgtgcggccttgttctcaccgacttcctggggctgctagtcacc
ggcgccatcgtggcgtcgcaacacgctgccttgttggactggcgagccactgaccccagc
tgccgcctgtgctacttcatgggggtagctatggtgttcttcgggctgtgtcccctgctc
ctgggggccgccatggcctctgagcgcttcgtgggcatcacacggcccttctcacgaccc
acggccacatcgcgccgcgcctgggctactgtcgggctggtgtgggtggcggccggggca
ctcgggctgctgccactactggggcttggccgctacagtgtgcagtaccccggctcttgg
tgcttcctgacactcgggacacagcgcggtgacgtggtcttcgggctcatattcgcactc
ctgggcagcgcgtccgtggggctgtccctcctgctcaacaccgttagtgtggccacactc
tgccgggtctaccacacgcgcgaggccacacagcgcccacgggactgcgaggtggagatg
atggttcagctcgtgggcatcatggtggtggccacggtgtgttggatgcccttgctggtc
ttcatcatgcagactttgttgcagacaccacctgtcatgagcttctctgggcagctgttg
cgggccacagagcaccagctgctcatctacctgcgtgtggccacctggaaccagatcttg
gacccctgggtctatatcctctttcgccggtctgtgctccggcgcctgcatccgcggttc
agttcacagctccaggctgtgtccttgcgccggcctccagcccaggccatgctcagtgga
ccctga

DBGET integrated database retrieval system