KEGG   Mus musculus (mouse): 21391Help
Entry
21391             CDS       T01002                                 

Gene name
Tbxas1, CYP5, CYP5A1, THAS, TS, TXAS, TXS
Definition
(RefSeq) thromboxane A synthase 1, platelet
  KO
K01832  thromboxane-A synthase [EC:5.3.99.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    21391 (Tbxas1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    21391 (Tbxas1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    21391 (Tbxas1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.5  thromboxane-A synthase
     21391 (Tbxas1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP5 family
   21391 (Tbxas1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 21391
NCBI-ProteinID: NP_035669
MGI: 98497
Ensembl: ENSMUSG00000029925
Vega: OTTMUSG00000034254
UniProt: P36423 Q3UTF0
Position
6 B1; 6 17.85 cM
AA seq 533 aa AA seqDB search
MEVLGLLKFEVSGTIVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNLMFFR
QGFWESQLELRERYGPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPKMV
ADSVLLLRDRRWEEVRGALMSSFSPEKLDEMTPLISQACELLVAHLKRYAASRDAFNIQR
CYCCYTIDVVASVAFGTQVDSQNSPEDPFVQHCRRASTFCIPRPLLVLILSFPSIMVPLA
RILPNKNRDELNGFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMV
PESLSSSECTKEPPQRCHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATH
PDCQERLLKEVDLFMGKHPAPEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEV
LGQRIPAGTVLEIAVGALHHDPEHWPNPETFDPERFTAEARLQRRPFTYLPFGAGPRSCL
GVRLGLLVVKLTILQVLHKFRFEASPETQVPLQLESKSALGPKNGVYIKIVSR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttggggcttctcaagtttgaagtcagtggtaccatagtgactgtgactctg
ctcgtggctctcttggccctcctgaaatggtactccatgtcagctttctcaagactggag
aagttgggcatcaggcaccccaagccttctccttttgttggaaacttgatgtttttccgc
cagggtttttgggagagccaattggaactccgagagcgatacgggcctctgtgtgggtac
tatcttggccgtcggatgcacgttgtcatttcagagccagacatgatcaagcaggtgttg
gttgagaacttcagtaacttttccaacagaatggcctcaggtctggaacccaagatggta
gcagacagtgtcctgttgttacgtgacagaagatgggaggaagtcaggggtgccctgatg
tcttcattcagtcctgaaaagttggatgagatgacacctctcatcagccaagcctgtgaa
cttctcgtggctcacttaaaacgctatgcagcatccagggacgcattcaacatccagagg
tgttactgctgttacaccatagatgtggtggccagtgtggcctttggcacccaggtggac
tcccagaattctccagaagatccctttgtgcaacactgccggcgtgcttccaccttctgt
atccccaggcctctcctggtattaatcttatcatttccatccataatggtcccattggcc
cggattctgcccaataagaaccgagatgaactgaatggcttttttaacacactcattagg
aatgtgattgccttacgggaccagcaagcagcagaagagaggcggagagacttcctgcag
atggtgctggatgcccagcactccatgaactctgtgggcgtggaaggctttgacatggtc
ccagaatccctgtcctcttctgagtgcacaaaggaaccaccccaaaggtgccatcctacc
tccacatctaagcctttcactgtggatgaaattgtgggccaggccttcctcttcctcatt
gcgggccatgaggtcatcacaaacacgctgtccttcatcacatacctgctggccacccac
cctgactgccaggagaggcttctgaaagaggtggacctcttcatggggaagcacccagcc
cctgagtaccacagcctgcaggaaggtctgccgtatctggacatggtgatttcagagacc
ctgaggatgtacccaccagctttcaggttcacacgggaggcagcacaggactgtgaggtg
ctgggacaacgtatccctgcaggtacagtgctggagatagctgtgggtgccctacaccat
gacccagagcactggccgaatcctgagacctttgaccctgaaaggttcacagcagaggcc
cggcttcagcggaggccgttcacatacctgccctttggagctggccccaggagctgcctc
ggagtgcggctgggcctgctggtggtcaagctgacaatactccaggtcctacacaagttc
cgctttgaagccagccctgagactcaggttccacttcagctagaatccaaatctgcccta
ggccccaaaaatggagtctacatcaagattgtgtcacgctga

DBGET integrated database retrieval system