KEGG   Mus musculus (mouse): 21393
Entry
21393             CDS       T01002                                 

Gene name
Tcap, AI503981, AJ223855
Definition
(RefSeq) titin-cap
  KO
K19879  telethonin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21393 (Tcap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21393 (Tcap)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    21393 (Tcap)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     21393 (Tcap)
SSDB
Motif
Pfam: Telethonin
Other DBs
NCBI-GeneID: 21393
NCBI-ProteinID: NP_035670
MGI: 1330233
Ensembl: ENSMUSG00000007877
Vega: OTTMUSG00000002713
UniProt: O70548 Q545G3
Position
11; 11 D
AA seq 167 aa
MATSELSCQVSEENQERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHRQGQCQAV
VQRSPWLVMRLGILGRGLQEYQLPYQRVLPLPIFTPTKVGASKEEREETPIQLRELLALE
TALGGQCVERQDVAEITKQLPPVVPVSKPGPLRRTLSRSMSQEAQRG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccacttcagagctgagctgccaagtgtctgaggagaaccaggaacgcagggaagcc
ttctgggctgagtggaaagacctgactctgtctacccggccggaagagggatgctccttg
cacgaggaggatacacagaggcatgagacctaccaccggcagggacagtgtcaggcggtg
gtacagcgctcaccatggctggtgatgcgcctgggtatcctcggccgtgggctacaggaa
taccagctgccgtaccagcgggtgctgcccctacccatcttcacgcccaccaaggtgggg
gcctccaaggaggagcgcgaggagacccccatccagcttcgggagctgctggccctggag
acggccctgggcggccagtgcgtggagcgccaggacgtggctgagatcacaaagcagctt
ccccctgtggtgccagtcagcaaacccgggcccctgcgccgtaccctgtctcgatccatg
tctcaggaagctcagagaggctga

DBGET integrated database retrieval system