KEGG   Mus musculus (mouse): 213990Help
Entry
213990            CDS       T01002                                 

Gene name
Agap3, AGAP-3, AV028425, Centg3, Crag, Crag., MRIP-1, cnt-g3
Definition
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    213990 (Agap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    213990 (Agap3)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    213990 (Agap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Imm30 Arf YidD Nodulin-like
Motif
Other DBs
NCBI-GeneID: 213990
NCBI-ProteinID: NP_001243360
MGI: 2183446
Ensembl: ENSMUSG00000023353
Vega: OTTMUSG00000053658
Position
5; 5 A3
AA seq 395 aa AA seqDB search
MNFQAGGGQSPQQQQSLAAPGTGGGGGGGAGGGGQFGGAGPGAGGGGPSQQLAGGPPQQF
ALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWTL
SRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDE
GGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAA
NPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKS
LPNSPSHSAVSAASIPAVHINQATNGGSSAFSDYSSSVPSTPSISQRELRIETIAASSTP
TPIRKQSKRRSNIFTICATVSNFSSTKRPFQLLPN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaggcaggcgggggccagagtcctcagcagcagcagagcctggcggctccg
gggaccggcggcggcggcggcggcggcgcggggggcggcgggcagttcggcggcgcgggg
cccggagccgggggtggcggcccctcgcagcagctggctggcggccccccccagcagttc
gcgctctccaactcggccgctatccgagccgagatccaacgcttcgagtcggtacacccc
aacatctacgccatctacgacctgatcgagcgaatcgaggatttggcgctgcagaaccag
atccgggagcacgtcatctccatcgaggactcatttgtgaacagccaggagtggaccctg
agccgctctgtgccagagcttaaagtgggcatagtgggcaacctgtctagtgggaaatca
gccttggttcaccgatatctgacagggacttatgtccaggaagagtcccctgaagggggt
cgatttaaaaaggagattgtagtggatggccagagttacctgctgctgatccgggatgaa
ggaggcccccctgaactccagtttgctgcctgggtggatgcggtggtgtttgtgttcagc
ctggaggatgaaatcagcttccagacggtgtacaactacttcctacgcctctgcagcttt
cgaaatgccagcgaggtgcccatggtgctggtgggcacacaggatgccatcagtgccgcc
aatccccgggtcattgatgacagcagggcccgcaaactgtccacagacctgaagcgctgt
acctactatgaaacatgcgcaacctatgggctcaatgtggaacgagtcttccaggacgtg
gcccagaaggtggtagccttgaggaagaagcagcagctggcgatcgggccctgcaagtcc
ctgcccaactcacccagccactcggccgtgtcagctgcctccatcccagctgtgcacatc
aatcaggccaccaacggaggcagcagcgccttcagcgactactcgtcctcagtcccctcc
acccctagcatcagccagcgggagctgcgcatcgagaccatcgctgcctcctccaccccc
acgcccatccgcaagcagtccaagcggcgttctaacatcttcacgatatgtgccactgtt
tccaacttttcatcaacaaaaaggcctttccaactccttccaaattag

DBGET integrated database retrieval system