KEGG   Mus musculus (mouse): 21402
Entry
21402             CDS       T01002                                 

Gene name
Skp1, 15kDa, 2610043E24Rik, 2610206H23Rik, EMC19, OCP-II, OCP2, Sk, Skp1a, Tceb1, Tceb1l, p19A, p19S, p19Skp1
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04710  Circadian rhythm
mmu05132  Salmonella infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    21402 (Skp1)
   04120 Ubiquitin mediated proteolysis
    21402 (Skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21402 (Skp1)
   04350 TGF-beta signaling pathway
    21402 (Skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    21402 (Skp1)
   04114 Oocyte meiosis
    21402 (Skp1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    21402 (Skp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21402 (Skp1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21402 (Skp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    21402 (Skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    21402 (Skp1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    21402 (Skp1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     21402 (Skp1)
   Cul7 complex
     21402 (Skp1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     21402 (Skp1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     21402 (Skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 21402
NCBI-ProteinID: NP_035673
MGI: 103575
Ensembl: ENSMUSG00000036309
Vega: OTTMUSG00000005625
UniProt: Q9WTX5 Q5SUR3
Position
11 B1.3; 11 31.86 cM
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcctacgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgactatcaagaccatgctggaagatttgggaatggatgatgaagga
gatgatgatcctgttcctttaccaaatgttaatgcagcaattctaaagaaggtcattcag
tggtgcacccaccacaaagatgaccctcctcctcctgaggatgatgaaaacaaagaaaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacatgc
aagactgtggccaatatgattaaggggaaaactcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaagaggcccaggtacgcaaagagaaccaatggtgt
gaagagaagtga

DBGET integrated database retrieval system