KEGG   Mus musculus (mouse): 21405
Entry
21405             CDS       T01002                                 

Gene name
Hnf1a, AI323641, HNF, HNF1, HNF1-, HNF1-alpha, HNF1[, HNF1[a], Hnf-, Hnf-1, Hnf1alpha, LFB, LFB1, Tcf-1, Tcf1
Definition
(RefSeq) HNF1 homeobox A
  KO
K08036  transcription factor 1, hepatocyte nuclear factor 1-alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    21405 (Hnf1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21405 (Hnf1a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, HNF1
    21405 (Hnf1a)
SSDB
Motif
Pfam: HNF-1B_C HNF-1_N HNF-1A_C Homeodomain Telethonin Homeobox_KN
Other DBs
NCBI-GeneID: 21405
NCBI-ProteinID: NP_033353
MGI: 98504
Ensembl: ENSMUSG00000029556
Vega: OTTMUSG00000014612
UniProt: P22361 Q66JY7
Position
5 55.99 cM; 5 F
AA seq 628 aa
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLMVGEGPLDKGESCGGSRGDLTEL
PNGLGETRGSEDDTDDDGEDFAPPILKELENLSPEEAAHQKAVVESLLQEDPWRVAKMVK
SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA
GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE
CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYNGPPPGPGPGPALP
AHSSPGLPTTTLSPSKVHGVRYGQSATSEAAEVPSSSGGPLVTVSAALHQVSPTGLEPSS
LLSTEAKLVSATGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPAS
LGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQ
SHVAQSPFMATMAQLQSPHALYSHKPEVAQYTHTSLLPQTMLITDTNLSTLASLTPTKQV
FTSDTEASSEPGLHEPPSPATTIHIPSQDPSNIQHLQPAHRLSTSPTVSSSSLVLYQSSD
SNGHSHLLPSNHSVIETFISTQMASSSQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggtttctaagctgagccagctgcagacggagctcctggctgccctgctcgagtctggc
ctgagcaaagaggccctgatccaggccttgggggagccagggccctacctgatggttgga
gagggtcccctggacaagggggagtcctgcggtgggagtcgaggggacctgaccgagttg
cctaatggccttggagaaacgcgtggctctgaagatgacacggatgacgatggggaagac
ttcgcgccacccattctgaaagagctggagaacctcagcccagaggaggcagcccaccag
aaagccgtggtggagtcacttcttcaggaggacccatggcgcgtggcgaagatggtcaag
tcgtacttgcagcagcacaacatcccccagcgggaggtggtggacaccacgggtctcaac
cagtcccacctgtcacagcacctcaacaagggcacacccatgaagacacagaagcgggcc
gctctgtacacctggtacgtccgcaagcagcgagaggtggctcagcaattcacccacgca
gggcagggcggactgattgaagagcccacaggcgatgagctgccaactaagaaggggcgt
aggaaccggttcaagtggggccccgcatcccagcagatcctgttccaggcctacgagagg
caaaaaaaccccagcaaggaagagcgagagaccttggtggaggagtgtaatagggcggag
tgcatccagaggggggtgtcaccatcgcaggcccaggggctaggctccaaccttgtcacg
gaggtgcgtgtctacaactggtttgccaaccggcgcaaggaggaagccttccggcacaag
ttggccatggacacctataacggacctccaccggggccaggcccgggccctgcgctgcct
gctcacagttcccccggcctgcccacaaccaccctctctcccagtaaggtccacggtgta
cggtacggacagtctgcaaccagtgaggcagccgaggtgccctccagcagcggaggtccc
ttagtcacagtgtctgcggccttacaccaagtatcccccacaggcctggagcccagcagc
ctgctgagcacagaggccaagctggtctcagccacggggggtcccctgcctcccgtcagc
accctgacagcactgcacagcttggagcagacatctccgggtctcaaccagcagccgcag
aaccttatcatggcctcgctacctggggtcatgaccatcgggcccggggagcctgcctcc
ctgggacccacgttcacgaacacgggcgcctccaccctggttatcggtctggcctccact
caggcacagagcgtgcctgtcatcaacagcatggggagtagcctgaccacgctgcagccg
gtccagttttcccaaccactgcatccctcctatcagcagcctctcatgccccccgtacag
agccacgtggcccagagccccttcatggcaaccatggcccagctgcagagcccccacgcc
ttatacagccacaagcctgaggtggcccagtacacgcacaccagcctgctcccgcagacc
atgttgatcacagacaccaacctcagcacccttgccagcctcacacccaccaagcaggtc
ttcacctcagacacagaggcctccagtgagcccgggcttcacgagccaccctctccagcc
accaccatccacatccccagccaggacccgtcgaacatccagcacctgcagcctgctcac
cggctcagcaccagtcccacagtgtcctccagcagcctggtgttgtatcagagttccgac
tccaacgggcacagccacctgctgccatccaaccatagtgtcatcgagacttttatctcc
acccagatggcctcctcttcccagtaa

DBGET integrated database retrieval system