KEGG   Mus musculus (mouse): 214058Help
Entry
214058            CDS       T01002                                 

Gene name
Megf11, 2410080H04Rik, D130061K05
Definition
(RefSeq) multiple EGF-like-domains 11
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF hEGF EGF_2 EGF SIT
Motif
Other DBs
NCBI-GeneID: 214058
NCBI-ProteinID: NP_001127871
MGI: 1920951
Ensembl: ENSMUSG00000036466
Vega: OTTMUSG00000031743
UniProt: Q80T91 E9Q918
Position
9; 9 C
AA seq 1095 aa AA seqDB search
MAPSAVGLLVFLLQAALALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWF
KCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECMHGRCVSPDTCHCE
PGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTH
GKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCH
HITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRC
QEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLP
CPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGS
CTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCP
SGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHA
DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFR
GPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQ
DCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQGCPSAFFGKDCGHICQCQNGASCDHI
TGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQ
AALMMDELNPYTKISPALGAERHSVGAVTGIVLLLFLVVVLLGLFAWRRRRQKEKGRDLA
PRVSYTPAMRMTSTDYSLSDLSQSSSHAQCFSNASYHTLACGGPATSQASTLDRNSPTKL
SNKSLDRDTAGWTPYSYVNVLDSHFQISALEARYPPEDFYIELRHLSRHAEPHSPGTCGM
DRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPESSYVEMKSP
VHLGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGRGHNSSYIQNPYDLPKNSHIPGHYDLL
PVRQSPAHGPFQEKQ
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctgcggtgggcctccttgtcttccttctgcaagctgctcttgctctgaac
cctgaagaccccaatgtgtgtagccactgggagagctatgccgtgactgtgcaggagtct
tatgcacacccctttgatcagatctactacacacgatgtgcagacatcctcaactggttc
aagtgtacccggcaccggatcagctataagaccgcgtataggcgcggcctccggaccatg
taccggcggaggtcccaatgctgccctggctactatgagaacggagacttctgcattcct
ctgtgtaccgaggagtgcatgcacggccgctgtgtctctcccgatacctgccactgtgag
cctggatggggaggccctgactgctccagcggctgtgacagcgagcactggggtccccac
tgcagcaaccggtgtcagtgtcagaacggcgccctgtgcaaccctatcaccggcgcctgc
gtgtgcgccccgggcttccgaggctggcgctgtgaggaactctgcgctcctggtactcac
ggcaagggctgccagctgctctgtcagtgccaccatggcgccagctgtgacccgcgcact
ggcgagtgcctctgcgctcctggctacacaggcgtttactgtgaggagctgtgcccccct
gggagccatggagctcactgtgagctgcgctgcccctgccagaatggaggcacctgccac
cacatcactggcgaatgtgcctgccctccaggctggacgggagcagtgtgtgcccagccc
tgccctccagggacctttggccagaactgtagccaggactgtccctgccaccatggaggc
cagtgtgaccatgtgactggacaatgccactgtacagctggatacatgggggacaggtgt
caagaagaatgtccctttggaacgttcggtttcctgtgctctcaacgctgtgactgccac
aatggaggtcaatgttcaccagccacaggggcctgtgagtgtgagcctggctacaagggc
cctagctgccaggagcggctatgccctgagggcctgcatggcccaggctgcaccttgccc
tgcccctgtgacaccgagaacactatcagctgccatccagttactggagcttgtacctgc
caaccaggctggtctggccactactgcaatgagtcctgccccgccggctactatggcaac
ggttgccagctaccctgcacctgccagaacggtgctgactgccacagtatcaccgggagc
tgcacttgtgctccaggcttcatgggagaggtgtgtgccgtcccctgtgctgcagggacc
tatggtcccaactgttcatctgtatgtagctgtagcaacggcggcacctgttccccagtg
gatggctcctgcacctgccgagagggatggcagggcctggactgctccctgccttgtccc
agtgggacctggggcctgaactgcaatgagacttgcatctgtgccaatggagctgcctgc
agcccctttgatgggtcctgtgcctgcaccccaggctggctgggggactcctgtgaactg
ccctgcccggacggcacttttgggctgaactgcagtgagcattgcgactgcagccatgct
gatggctgtgaccctgtcacaggccactgctgctgcctggcaggatggacaggcatccgc
tgtgatagcacgtgtcctccaggtcgctggggccccaactgttcagtgtcctgcagctgt
gagaacggaggttcctgctccccggaggacgggagctgcgagtgtgcccctggctttcga
ggacccttatgtcagagaatctgcccaccaggattctacggccatggctgcgcccagcct
tgtcccctctgcgtgcacagcagggggccctgccaccacatcagtggtatctgtgagtgc
ctgccaggattctctggagccttgtgcaaccaagtgtgtgctggagggcacttcgggcag
gactgtgcccagctctgttcctgtgccaacaatgggacctgcagccccatcgatggctcc
tgtcagtgcttccctgggtggattggcaaggactgctcacagggttgcccttcagcattt
tttgggaaggactgtgggcacatatgccagtgtcagaatggagccagctgtgaccacatc
actgggaaatgcacctgtcgaacaggcttctctggccgccactgtgaacagagatgtgcc
cctggaacctttggatatgggtgtcagcagctatgtgagtgcatgaacaatgccacttgt
gaccacgtcactggtacctgttactgtagcccgggattcaaaggaatcaggtgtgaccaa
gctgccctcatgatggatgagctgaatccctacaccaagatcagtccagctctgggagca
gagcggcactcagtgggtgctgtcaccggcatcgttctcctgttgttcctggtggtggtg
ctgctgggcctgtttgcctggcgacggaggcggcagaaagagaaaggccgtgacctggct
ccccgagtctcctacaccccagccatgaggatgaccagcacagactactctctctcagat
ttgtctcaaagtagcagccatgcccagtgcttttccaatgccagctaccacacactggcg
tgtggggggcctgccaccagccaggccagcactctggacaggaacagccccaccaagctc
agtaacaagtcccttgacagagacacagcaggctggaccccctacagctatgtgaacgtg
ttagactcccatttccagatcagtgccctggaggccaggtacccgcccgaggacttctac
attgaacttagacacctcagccgccatgctgagccacactcaccaggcacttgtggaatg
gacagacgtcagaacacatacattatggacaaaggcttcaaagattacatgaaagaatct
gtgtgcagttctagcacttgctccttgaacagcagtgaaaacccttacgccacaattaag
gacccacccatcctcacctgcaagcttccagaaagcagttatgtagaaatgaagtcacct
gtgcacttggggtctccgtacacagatgtgccatccttgtcgacatctaataaaaatata
tatgaagttgagcccacagtcagtgtggtccaagaaggccgaggtcataactccagctat
atccagaatccatacgacctacctaagaacagccatattcctggtcactatgacctcctc
ccagtaagacagagccctgcccatgggcccttccaggaaaagcagtaa

DBGET integrated database retrieval system