KEGG   Mus musculus (mouse): 214063Help
Entry
214063            CDS       T01002                                 

Gene name
Dnajc16, 2900037O03Rik, 4732437J24Rik, D030060M24, mKIAA0962
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C16
  KO
K09536  DnaJ homolog subfamily C member 16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    214063 (Dnajc16)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   214063 (Dnajc16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ Thioredoxin IRK Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 214063
NCBI-ProteinID: NP_758841
MGI: 2442146
Ensembl: ENSMUSG00000040697
Vega: OTTMUSG00000009933
UniProt: Q80TN4
Structure
PDB: 

Position
4; 4 E1
AA seq 772 aa AA seqDB search
MELKRLGVSWRFLMVLVLILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDK
NKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGDAGENQGYQKQQREHRFRHFHENFYFD
ESFFHFPFNAERRDSGDEKYLLHFSHYVNEVLPESFKRPYLIKITSDWCFSCIHIEPVWK
EVVQELEGLGVGIGVVHAGYERRLAHHLGAHSTPSILGVISGKITFFHNAVVHENLRQFV
ESLLPGNLVEKVTNKNYVRFLSGWQQENKPHALLFGQTPAVPLMYKLTAFAYKDYVSFGY
VYVGLRGVEEMTRQYNVNLYTPTMLIFKEHINKPADVIQARGLKKQVIEDFIAQNKYLLA
SRLTSQRLFHELCPVKRSHRQRKYCVVLLTAETNKVSKPFEAFLSFALANTQDTVRFVHV
YSNRQQEFASTLLPDMEAFQGKSGVSILERRNTAGRVVFKTLEDPWTGSESDKFVLLGYL
DQLRKDPAFLSSEAVLPDLTDELAPVFFLRWLYSVSDYLSDFWESLLHSNWREMMPLLSL
IFSALFILFGTVMVQAFSDSNEERESHPADKEEVPEKAGKTEPSFTKESSSKIPKKGFVE
VTELTDVTYTSNLVRLRPGHMNVVLILSNSTKTSLLQKFALEVYTFTGSSSLHFSFLTLD
KHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPLKTVDEETV
ASCDPDSSRGKPSCGLGPKPLKGKLSKLSLWMERLLEGSLQRFYIPSWPELD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaaaaggttgggcgtgtcctggcgattcttgatggttctggttctgatcctg
caaagcctgtctgcattggattttgacccatacagagtcctaggggtcagccgcacggcc
agtcaggctgacattaaaaaggcatataagaagctcgctcgggaatggcatcctgacaaa
aacaaagaccctggagccgaggacaggttcattcagatcagcaaggcatacgagatcctg
tccaatgaggaaaagaggacaaactacgaccactatggtgatgccggtgagaaccaaggc
taccagaagcagcagcgcgaacaccgcttccgccatttccacgagaacttctattttgat
gagtcctttttccacttccccttcaatgcggagcggcgggactcgggtgacgagaagtac
ttgctgcacttctcacactacgtgaatgaagtgcttcccgagagcttcaaaagaccctac
ctcatcaagatcacgtcagactggtgcttcagctgcatccatatcgagcctgtctggaag
gaggtggtccaggaactggaaggactgggtgtggggattggtgtcgtccacgctgggtac
gaaaggcgcctggcccatcacctgggagcacacagcaccccctccatccttggggtcatc
agtgggaagatcaccttcttccacaacgcagtggtccatgaaaacctacggcagttcgtg
gagagtcttctcccaggaaacttggtagagaaggtcacaaataaaaattatgtgcggttc
ctctctggctggcagcaggagaataagccacacgccctcctgttcggccagacaccagca
gtgccactgatgtacaagttgacggccttcgcatacaaggattatgtgtcgtttggatac
gtgtatgtcggcttgagaggtgtggaagagatgaccaggcagtacaacgtcaacctctat
acccccaccatgctcatcttcaaagagcacataaacaagcccgctgatgtgatccaggct
cggggactgaagaagcaggtcatcgaggacttcatcgcccaaaacaagtacctgctggcc
tcccggctcaccagccagaggttgttccatgaactctgccctgtgaagcggtctcaccga
cagagaaaatactgcgtggttttactgacagctgagactaacaaagtgagcaaacccttt
gaagccttcctgtcatttgccctggcaaacactcaagacacggtacggttcgtgcatgtc
tacagcaaccgacagcaggagtttgccagcacattgctaccggacatggaagctttccag
gggaagtcaggggtgtccatcttggaaaggaggaacacagcggggagggtggtgttcaaa
accctggaggatccctggaccggcagtgagagcgataagttcgtccttttgggttatctt
gaccagctgcggaaggatccagcatttctgtcttcagaagctgtgctccctgacctgact
gacgagctggctcctgtatttttcctccggtggctctactctgtttctgactacctctcg
gacttctgggagagcctgcttcacagtaactggcgggagatgatgcccctgctgtccctc
atcttctcggccctcttcatcctcttcggcacggtcatggtccaggctttcagtgactca
aatgaggagcgagagtcgcaccctgcagacaaagaggaagtccccgagaaggctgggaag
actgagccgagcttcaccaaagagagcagcagcaagattcctaagaaaggctttgtggag
gtgactgaactcacagatgtgacgtacaccagcaatttggtacgcctgaggcctggtcac
atgaatgtggtcctgatcctgtccaattccactaagacaagcctcctgcagaagtttgct
ttggaagtctacacattcaccgggagcagcagcctccacttctccttcctgacactggac
aaacaccgggagtggctggagtatttgctagagtttgctcaggatgcggccccgatccca
aaccagtatgacaagcactttatggaacgagactacactggctacgtgctggccctgaac
ggtcacaagaagtatttctgccttttcaagccactaaagacagtggatgaggagactgtg
gcctcctgtgaccctgactcctcccgagggaagccttcctgtggccttggccccaagccc
ctcaaaggcaagctgagcaagttgtccttgtggatggagcgcctgctggaaggctccttg
cagaggttctacatcccgtcgtggcctgagctggactga

DBGET integrated database retrieval system