KEGG   Mus musculus (mouse): 21410
Entry
21410             CDS       T01002                                 

Gene name
Hnf1b, HNF-1-beta, HNF-1B, HNF-1Be, HNF-1Beta, Hnf1be, Hnf1beta, LFB, LFB3, Tcf-2, Tcf2, vHN, vHNF1
Definition
(RefSeq) HNF1 homeobox B
  KO
K08034  transcription factor 2, hepatocyte nuclear factor 1-beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    21410 (Hnf1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21410 (Hnf1b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, HNF1
    21410 (Hnf1b)
SSDB
Motif
Pfam: HNF-1B_C HNF-1_N Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 21410
NCBI-ProteinID: NP_033356
MGI: 98505
Ensembl: ENSMUSG00000020679
Vega: OTTMUSG00000000988
UniProt: P27889
Position
11 C; 11 51.23 cM
AA seq 558 aa
MVSKLTSLQQELLSALLSSGVTKEVLIQALEELLPSPNFGVKLETLPLSPGSGADLDTKP
VFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWR
AAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREIL
RQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQNQGPGQSEDTCSEPTNKKMRRNRFKWGP
ASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWF
ANRRKEEAFRQKLAMDAYSSNQTHNLNPLLTHGSPHHQPSSSPPNKMSGVRYNQPGNNEV
TSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHSLLSPDSKMQITVSGGGLPPVSTLTNI
HSLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQGVPVINSVASSLAALQPVQFSQQLH
SPHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSS
INTLTSMSSSKQCPLQAW
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggtgtccaagctcacgtcgctccagcaagaactcctgagtgccctgctgagctccgga
gtcaccaaggaagtgctgatccaggccttggaggagttactgccgtccccgaatttcggg
gtgaagctggagacactgcccctgtcccccgggagcggggcggatctcgacaccaagccg
gttttccatactctcaccaatggccacgccaagggccgcttgtctggggacgagggctca
gaggacggcgacgactatgacactcctcccatcctcaaagagctccaggcgctcaacacc
gaggaggccgcggagcagcgggccgaggtggaccggatgctcagcgaggacccgtggagg
gctgccaaaatgatcaagggatacatgcaacagcacaatatcccccagagggaggtggtc
gatgtcacaggcctgaaccaatcccacctctctcaacacctcaacaagggcacccccatg
aagacccagaagagagctgccctgtacacttggtacgtcagaaagcaacgggagatcctc
cgacagttcaaccagacagtccagagctctggaaacatgacagacaaaagcagtcaggat
cagctgctgtttctctttccagagttcagtcaacagaaccaggggcctgggcagtcggag
gacacctgctccgagcccaccaacaagaagatgcgccgcaaccggtttaaatgggggccc
gcatcccagcaaattttgtaccaggcctacgaccggcaaaagaatcccagcaaggaagag
agggaggccttagtggaggagtgtaacagggcagaatgtttgcaacgaggggtctcccct
tccaaagcccacggcctaggctccaacttggtcacggaggtccgtgtctacaactggttc
gcaaaccgccggaaggaagaggcgttcaggcagaagctggccatggatgcctatagctcc
aaccagacgcacaacctgaaccccctgctcacccatggctcccctcaccatcagccaagc
tcctctccacccaacaagatgtcaggagtgcgctacaaccagccgggaaacaatgaggtc
acttcctcttcgacaatcagtcaccatggtaacagtgccatggtgaccagccagtcggtt
ttacagcaagtctccccagccagcctggacccaggccacagtctcctctcacctgacagt
aaaatgcagatcacagtgtcgggaggaggactgcctcccgtcagcaccttgacgaatatc
cacagcctctcccaccacaatccccagcaatctcagaacctcatcatgacccccctgtct
ggagtcatggccattgcacagagcctcaacacctcccaagcccagggtgtcccggtcatt
aacagtgtggctagcagcctggcagccctacagcccgtccagttctctcaacagctgcac
agccctcaccagcagcccctcatgcagcagagcccaggcagtcacatggcccagcagccc
ttcatggccgcggtgactcagctacagaactcccacatgtatgcacataagcaggaaccc
ccccagtattcccacacctcccggttcccatctgcaatggtggtcacagataccagtagc
atcaacactctcaccagcatgtcttccagtaaacagtgtccactgcaagcctggtga

DBGET integrated database retrieval system