KEGG   Mus musculus (house mouse): 214133
Entry
214133            CDS       T01002                                 
Symbol
Tet2, Ayu17-449, E130014J05Rik, mKIAA1546
Name
(RefSeq) tet methylcytosine dioxygenase 2
  KO
K24309  methylcytosine dioxygenase TET2/3 [EC:1.14.11.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    214133 (Tet2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    214133 (Tet2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-
     214133 (Tet2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    214133 (Tet2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    214133 (Tet2)
SSDB
Motif
Pfam: Tet_JBP Pam16
Other DBs
NCBI-GeneID: 214133
NCBI-ProteinID: NP_001035490
MGI: 2443298
Ensembl: ENSMUSG00000040943
UniProt: Q4JK59
Position
3:complement(133169438..133250882)
AA seq 1912 aa
MEQDRTTHAEGTRLSPFLIAPPSPISHTEPLAVKLQNGSPLAERPHPEVNGDTKWQSSQS
CYGISHMKGSQSSHESPHEDRGYSRCLQNGGIKRTVSEPSLSGLHPNKILKLDQKAKGES
NIFEESQERNHGKSSRQPNVSGLSDNGEPVTSTTQESSGADAFPTRNYNGVEIQVLNEQE
GEKGRSVTLLKNKIVLMPNGATVSAHSEENTRGELLEKTQCYPDCVSIAVQSTASHVNTP
SSQAAIELSHEIPQPSLTSAQINFSQTSSLQLPPEPAAMVTKACDADNASKPAIVPGTCP
FQKAEHQQKSALDIGPSRAENKTIQGSMELFAEEYYPSSDRNLQASHGSSEQYSKQKETN
GAYFRQSSKFPKDSISPTTVTPPSQSLLAPRLVLQPPLEGKGALNDVALEEHHDYPNRSN
RTLLREGKIDHQPKTSSSQSLNPSVHTPNPPLMLPEQHQNDCGSPSPEKSRKMSEYLMYY
LPNHGHSGGLQEHSQYLMGHREQEIPKDANGKQTQGSVQAAPGWIELKAPNLHEALHQTK
RKDISLHSVLHSQTGPVNQMSSKQSTGNVNMPGGFQRLPYLQKTAQPEQKAQMYQVQVNQ
GPSPGMGDQHLQFQKALYQECIPRTDPSSEAHPQAPSVPQYHFQQRVNPSSDKHLSQQAT
ETQRLSGFLQHTPQTQASQTPASQNSNFPQICQQQQQQQLQRKNKEQMPQTFSHLQGSND
KQREGSCFGQIKVEESFCVGNQYSKSSNFQTHNNTQGGLEQVQNINKNFPYSKILTPNSS
NLQILPSNDTHPACEREQALHPVGSKTSNLQNMQYFPNNVTPNQDVHRCFQEQAQKPQQA
SSLQGLKDRSQGESPAPPAEAAQQRYLVHNEAKALPVPEQGGSQTQTPPQKDTQKHAALR
WLLLQKQEQQQTQQSQPGHNQMLRPIKTEPVSKPSSYRYPLSPPQENMSSRIKQEISSPS
RDNGQPKSIIETMEQHLKQFQLKSLCDYKALTLKSQKHVKVPTDIQAAESENHARAAEPQ
ATKSTDCSVLDDVSESDTPGEQSQNGKCEGCNPDKDEAPYYTHLGAGPDVAAIRTLMEER
YGEKGKAIRIEKVIYTGKEGKSSQGCPIAKWVYRRSSEEEKLLCLVRVRPNHTCETAVMV
IAIMLWDGIPKLLASELYSELTDILGKCGICTNRRCSQNETRNCCCQGENPETCGASFSF
GCSWSMYYNGCKFARSKKPRKFRLHGAEPKEEERLGSHLQNLATVIAPIYKKLAPDAYNN
QVEFEHQAPDCCLGLKEGRPFSGVTACLDFSAHSHRDQQNMPNGSTVVVTLNREDNREVG
AKPEDEQFHVLPMYIIAPEDEFGSTEGQEKKIRMGSIEVLQSFRRRRVIRIGELPKSCKK
KAEPKKAKTKKAARKRSSLENCSSRTEKGKSSSHTKLMENASHMKQMTAQPQLSGPVIRQ
PPTLQRHLQQGQRPQQPQPPQPQPQTTPQPQPQPQHIMPGNSQSVGSHCSGSTSVYTRQP
TPHSPYPSSAHTSDIYGDTNHVNFYPTSSHASGSYLNPSNYMNPYLGLLNQNNQYAPFPY
NGSVPVDNGSPFLGSYSPQAQSRDLHRYPNQDHLTNQNLPPIHTLHQQTFGDSPSKYLSY
GNQNMQRDAFTTNSTLKPNVHHLATFSPYPTPKMDSHFMGAASRSPYSHPHTDYKTSEHH
LPSHTIYSYTAAASGSSSSHAFHNKENDNIANGLSRVLPGFNHDRTASAQELLYSLTGSS
QEKQPEVSGQDAAAVQEIEYWSDSEHNFQDPCIGGVAIAPTHGSILIECAKCEVHATTKV
NDPDRNHPTRISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGK
QEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
NT seq 5739 nt   +upstreamnt  +downstreamnt
atggaacaggacagaaccacccatgctgagggcaccagactgagtccattcctgatagca
ccaccttctcccatcagccatacagaacctctggctgtcaaactccagaatggaagcccg
ttagcagagagacctcatccagaagtaaatggagacaccaagtggcaatcttcccaaagc
tgttatggaatatcccacatgaaaggcagccagagcagtcatgagagtccacatgaagac
agagggtattccaggtgcttacagaatggagggataaaacgcacagtcagtgaaccatct
ctctctgggctccatccaaacaagatattgaaactagaccaaaaagctaagggagaaagc
aatatcttcgaggaaagccaagaaagaaaccacggtaaaagcagccgtcagccaaatgtc
tccggactaagtgataatggagagcccgtgacctcgaccacccaggaaagttcaggtgca
gatgctttcccaacacggaactacaatggagttgaaattcaggttctcaacgagcaggaa
ggggaaaaaggcaggagcgttacattacttaaaaacaagattgtgctaatgcctaatggt
gctacagtttctgcccattctgaggagaacacacgtggtgaactcctggaaaaaacacag
tgttatccagattgtgtctccattgccgtgcagagtaccgcatctcatgtaaacacccct
agcagtcaggctgctatcgagttgtcccacgagatccctcaaccatcgcttacctcagcg
cagatcaatttctcccagacctcaagcttgcagctgcctccagagccagctgcaatggtg
actaaggcctgtgatgctgataatgccagtaaaccagctatagtaccaggtacctgtcct
tttcagaaagcagaacaccaacaaaagtcagctttggacataggcccatctcgtgcagaa
aacaaaaccatccaaggaagcatggagctatttgctgaagaatactatcctagttccgac
cggaatttgcaagcttcgcatggcagctctgaacagtattcaaagcaaaaggaaaccaat
ggtgcttacttcaggcaaagctcgaagttccctaaagattccatctctcccactactgtg
accccaccgtcacaatcacttcttgctccccgtcttgttcttcagcctcctttagaagga
aaaggcgctctaaatgatgtagctttggaagaacaccatgactaccccaaccgaagcaac
cgaactcttttaagggaagggaaaatagaccatcaacccaagacatcatctagccagagt
ctgaatccatctgtacatacacccaacccccccttgatgcttccagaacagcatcagaat
gattgtggctcaccgagccctgaaaagtcaagaaaaatgtcagaatatctcatgtattac
ctgccaaatcatggccacagtggaggtttacaagaacatagccaatacctgatggggcac
agggagcaagagattccgaaggatgcaaacgggaaacaaacgcaaggctctgtacaggca
gcacctggctggatagaactgaaagccccgaatttgcatgaagcactccatcagacaaaa
cgcaaggatatatccttgcactcagtcctccactctcagaccggccctgtcaatcagatg
agctccaaacagtccactggcaatgtcaacatgccaggaggattccaaaggctaccttac
ctccagaaaacagcccagccagagcagaaggcacaaatgtaccaagtgcaagtgaaccaa
ggaccgtctccaggtatgggggaccaacatcttcagttccagaaagctttataccaggag
tgcatccccaggacagatccgtcatctgaggctcacccgcaagcaccgagcgttcctcag
tatcatttccagcaaagagtaaatccctccagtgataagcatttgagtcaacaggccaca
gagactcaacggttatcaggctttttacaacatactcctcagacgcaggcatcacaaaca
ccagcatcccagaactcaaatttccctcaaatctgccagcagcagcagcagcagcagtta
cagaggaagaataaagagcaaatgcctcagactttctctcatctccaaggtagcaatgat
aagcaaagagaaggctcgtgctttggccagattaaagtggaagaaagcttttgtgtcgga
aatcagtactccaaatcaagtaatttccaaactcacaataatacccaaggggggttggag
caagtacaaaatataaataaaaattttccttattcgaagatcttaacaccaaattcgagc
aacttacagattctcccttcaaatgacacacacccggcttgtgagcgggaacaagctcta
catcccgtaggaagtaagacctcaaacctgcagaacatgcagtatttcccgaataatgtg
accccaaatcaggacgttcaccggtgctttcaggaacaagcgcagaagcctcagcaagct
tcgtctctacaggggcttaaggacagaagccagggtgagtctccagccccaccagctgag
gcagctcaacagaggtatttggtgcataatgaagcaaaggcactccctgtgcctgagcaa
ggaggaagtcagacacagacccctcctcagaaggacactcagaagcacgctgccttaagg
tggcttctcttacagaagcaagaacagcagcaaacacagcaatcccagcctggtcataac
cagatgcttaggccaatcaagactgagcctgtatccaaaccttcttcctatagatacccc
ttgtcaccgccacaagaaaatatgtccagcaggataaagcaagagatctcctctccaagc
cgtgacaatgggcagccaaagagcatcattgagaccatggaacagcacctgaagcagttt
cagctcaagtcactctgtgactataaggctctgactctcaagtcacagaaacacgtgaaa
gtgccaacagatatccaggctgcagaatcggagaaccacgcccgagctgcagagcctcaa
gcaaccaaaagcacagattgttctgttctcgacgatgtttcagaatcagatactcctggt
gaacaaagtcagaatggcaaatgtgaaggatgcaatccagacaaagatgaagctccttat
tatacccatctaggagctggtcctgatgtggcagctattagaacactcatggaagaaagg
tatggagagaagggtaaagctattaggattgaaaaagtcatatatactggtaaagaaggc
aagagctctcagggatgtcctattgctaaatgggtatatcggagatcgagtgaggaggag
aaactactgtgtttggtacgagtgcgacctaatcacacatgtgagacggcggtgatggta
attgccatcatgttgtgggacggaatcccaaagctactcgcatcagaactctactcagaa
cttacagatatcttgggcaagtgtggcatatgcaccaaccgtcgctgttctcagaatgaa
actagaaactgttgttgtcagggtgagaatccagagacctgtggtgcctccttttctttt
ggttgttcttggagcatgtactataatggatgtaagtttgccagaagcaagaaaccaagg
aaatttaggctacatggagctgagccaaaagaggaagagagactaggttctcatttgcaa
aacctggctactgtcattgctccaatatacaagaagcttgcacccgatgcatacaataat
caggttgaatttgaacaccaagccccagactgctgtttgggtctgaaggaaggccggcca
ttctcaggagtcactgcatgtttggacttctctgctcattcccacagagaccagcagaac
atgccaaatggcagtacagtggtggtcaccctcaatagagaagacaatcgagaagtcgga
gctaagcctgaggatgagcagttccacgtgctgcctatgtacatcatcgcccctgaggat
gagtttgggagtacggaaggccaggagaagaagatacggatggggtccattgaggttctg
cagtcatttcggaggagaagggtcataaggataggagagctgcccaagagttgcaagaag
aaagcggagcccaagaaagccaagaccaagaaagcagctcgaaagcgttcctctctggag
aactgctccagtaggactgagaagggaaagtcttcctcacatacaaagctgatggaaaat
gcaagccatatgaaacaaatgacagcacaaccgcagctttcgggcccggtcatccggcag
ccaccaacactccagaggcaccttcagcaagggcagaggccacagcagccgcagccacct
cagccgcagccgcagacgacacctcagccacagccacagccacagcatatcatgcccggt
aactctcagtctgttggttctcattgttctggatccaccagtgtctacacgagacagcct
actcctcacagtccttatcccagctcagcacacacctcagatatttatggagataccaac
catgtgaacttttaccccacttcatctcatgcctcgggttcatatttgaatccttctaat
tacatgaacccctaccttgggcttttgaatcagaataaccaatatgcaccttttccatac
aatgggagtgtgccagtggacaatggttcccctttcttaggttcttattccccccaggct
cagtccagggatctacatagatatccaaaccaggaccatctcaccaatcagaacttacca
cccatccacacccttcaccaacagacgtttggggacagtccctctaagtacttaagttat
ggaaaccaaaatatgcagagagatgccttcactactaactccaccctaaaaccaaatgta
caccacctagcaacgttttctccttaccccacccccaagatggatagtcatttcatggga
gctgcctccagatcaccatacagccacccacacactgactacaaaaccagtgagcatcat
ctaccctctcacacgatctacagctacacggcagcagcttcggggagcagttccagccac
gccttccacaacaaggagaatgacaacatagccaatgggctctcaagagtgcttccaggg
tttaatcatgatagaactgcttctgcccaagaactattatacagtctgactggcagcagt
caggagaagcagcctgaggtgtcaggccaggatgcagctgctgtgcaggaaattgagtat
tggtcagatagtgagcacaactttcaggatccttgcattggaggggtggctatagctcca
actcatgggtcaattcttattgagtgtgcaaagtgtgaggttcatgccacaaccaaagta
aacgatcccgaccggaatcaccccaccaggatctcacttgtactgtataggcataagaat
ttgtttctaccaaaacattgtttggctctctgggaagccaaaatggctgaaaaggcccgg
aaagaggaagagtgcggaaagaatggatcagaccacgtgtctcagaaaaatcatggcaaa
caggaaaagcgtgagcccacagggccacaggaacccagttacctgcgtttcatccagtct
cttgctgagaacacagggtctgtgactacggattctaccgtgactacatcaccatatgct
ttcactcaggtcacagggccttacaacacatttgtatga

DBGET integrated database retrieval system