KEGG   Mus musculus (mouse): 214137Help
Entry
214137            CDS       T01002                                 

Gene name
Arhgap29, 6720461J18Rik, A830014I19, AU040217, B130017I01Rik, C76601, Parg1
Definition
(RefSeq) Rho GTPase activating protein 29
  KO
K20644  Rho GTPase-activating protein 29/45
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    214137 (Arhgap29)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    214137 (Arhgap29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP C1_1 ELL LZ3wCH
Motif
Other DBs
NCBI-GeneID: 214137
NCBI-ProteinID: NP_766113
MGI: 2443818
Ensembl: ENSMUSG00000039831
Vega: OTTMUSG00000026603
UniProt: Q8CGF1
Position
3; 3 G1
AA seq 1266 aa AA seqDB search
MIAHKQKKAKKKRVWASGQPSAAITTSEMGLKSVSSSSSFDPEYIKELVNDVRKFSHMLL
YLKEAILSDCFKEVIHIRLDELLRVLKSILSKHQNLSSVDLQSAAEVLTAKVKAVNFTEV
NEENKNDIFREVFSSIETLAFTFGNILTNFLMGDVGSDSILRLPISRESKSFENISVDSV
DLPHEKGNFSPIELDNLLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNI
VKLAEATRSSIGIQEFMPLQSLFTNALLSDIHSSHLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKDLWKQQQNKLLETETALKKAKLLCMQRQDEYEKAKSSMFRAEEEQLSSSVGL
AKNLNKQLEKRRRLEEEALQKVEEANEHYKVCVTNVEERRNDLENTKREILTQLRTLVFQ
CDLTLKAVTVNLFHMQQLQAASLANSLQSLCDSAKLYDPGQEYSEFVKATSSSELEEKVD
GNVNKQMTNSPQTSGYEPADSLEDVARLPDSCHKLEEDRCSNSADMTGPSFVRSWKFGMF
SDSESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSEAGPNSL
GAFKKTLMSKAALTHKFRKLRSPTKCRDCDGIVMFPGVECEECLLVCHRKCLENLVIICG
HQKLQGKMHIFGAEFIQVAKKEPDGIPFVLKICASEIENRALCLQGIYRVCGNKIKTEKL
CQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQE
AKKDSPEDKKHPHVSIEVNRILLKSKDLLRQLPASHFNSLHYLIAHLRRVVDHAEENKMN
SKNLGVIFGPTLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIFDGSLQPQAVVIS
NTGAVAPQVDQGYLPKPLLSPDERDTDHSMKPLFFSSKEDIRSSDCESKSFELTTSFEES
ERRQNALGKCDAPLLDNKVHLLFDQEHESASQKMEDVCKSPKLLLLKSNRAANSVQRHTP
RTKMRPVSLPVDRLLLLASSPTERSSRDVGNVDSDKFGKNPAFEGLHRKDNSNTTRSKVN
GFDQQNVQKSWDTQYVRNNFTAKTTMIVPSAYPEKGLTVNTGNNRDHPGSKAHAEPARAA
GDVSERRSSDSCPATAVRAPRTLQPQHWTTFYKPPNPTFSVRGTEEKTALPSIAVPPVLV
HAPQIHVTKSDPDSEATLACPVQTSGQPKESSEEPALPEGTPTCQRPRLKRMQQFEDLED
EIPQFV
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcacaaacagaaaaaggcaaagaaaaagcgtgtttgggcatcaggccaacct
tctgctgctattacaacttctgaaatggggctcaagtccgtaagttccagctccagtttt
gatccggagtacatcaaggagctggtgaatgatgtcaggaagttctcccatatgttgcta
tatttgaaagaagctattctttcagactgttttaaagaagtcattcatatccgtctggat
gagcttctccgtgttttaaagtcgatattgagcaagcatcagaacctcagctccgtagat
cttcagagcgctgcagaggtgctcactgcaaaagtgaaagctgtgaactttacagaagtt
aatgaagaaaacaaaaacgatatattccgagaagtcttttcctccattgaaacattggca
tttacctttggaaacatcctcacaaacttccttatgggagacgtaggcagtgactcgata
ctacgtctacctatttctcgagaaagtaagtcttttgaaaacatttctgtggactcagtg
gacttaccccatgaaaaaggaaatttttctcctatagaactagacaacttgctgttaaag
aacactgactctatagagctggctttgtcctatgctaaaacatggtcaaaatataccaag
aatatagtgtcgtgggttgaaaaaaagctcaacttggaattggagtccactagaaatatt
gtaaaattggcagaggcaactagatctagcattggtatacaagagtttatgccactgcag
tctctatttaccaacgctcttctcagtgacatccacagcagccaccttctacaacagaca
attgcagccctccaagccaataaatttgtgcagcctctacttgggaggaagaatgagatg
gagaagcaaaggaaagaaataaaagacctttggaagcagcaacagaataaattgctcgaa
acagagacagctctcaaaaaagcaaaattgttgtgcatgcagcggcaagatgaatacgaa
aaggcaaaatcgtccatgtttcgtgcagaagaagagcagctaagttcaagtgttggtttg
gcaaaaaatctcaacaaacaactggaaaaaaggcggaggttggaagaagaggctcttcaa
aaagtagaagaagcaaacgaacactacaaagtctgtgtaacaaatgttgaagaaagacgg
aatgatctagaaaatacaaagagggaaattttaacacagcttcggacacttgttttccag
tgtgaccttacacttaaagctgtaacagttaacctctttcatatgcagcagctacaggct
gcatcccttgccaacagtttacagtccctctgtgacagtgccaaactctatgatccaggt
caggagtacagtgaattcgtgaaggctacaagctcaagtgaattagaagaaaaggttgat
gggaatgtaaataaacaaatgaccaacagtccgcagacatctggctatgaacctgctgac
tccttagaggatgttgcccgccttcctgacagctgtcataagcttgaagaggacaggtgc
tccaacagtgcagacatgacaggtccttctttcgtaagatcatggaagttcggaatgttt
agtgactcagagagcactggaggaagcagtgagtctagatctctggattcagagtctata
agtccaggagactttcatcggaaacttccacggactccatccagtggaaccatgtcttct
gctgatgatctcgatgagagagagccaccgtccccttcagaagctggacccaattccctc
ggagcatttaagaaaactttgatgtcaaaggcagctctcactcacaagtttcgcaagttg
agatccccgacaaagtgcagggattgtgacggcatcgtaatgttcccaggcgtcgagtgt
gaagagtgtctccttgtttgtcatcggaagtgtctggagaatttagtcattatttgtggt
catcaaaaacttcagggaaaaatgcacatatttggagcagaattcatacaagttgcaaaa
aaggaaccagatggcatcccttttgtactgaaaatatgtgcctcagaaattgaaaataga
gccttgtgtctccagggaatttatcgtgtttgtggaaacaaaataaaaactgaaaaactg
tgccaagctttggaaaatgggatgcacttagtagacatttcagaattcagttcacatgac
atctgtgatgtcttgaaattatacctgcgacagcttccagaaccatttattttattcaga
ttgtacaaggaatttatagaccttgcaaaagagatacaacatgtaaatgaagaacaagag
gcaaaaaaagatagccctgaagacaagaaacacccacatgtgagcatagaagtcaaccgc
atccttctgaagagcaaagacctgctgagacagctgccagcgtcacatttcaacagcctc
cattacctcatagcacatctgaggcgagtggtggatcatgcagaagagaacaagatgaat
tctaagaacttgggggtgatatttggaccaactctcattaggccaaggcctacaacggct
cctgtcaccatctcgtcccttgctgaatattccaatcaggcacgattagtagagttcctt
attacttactcacagaagatcttcgatgggtccctccagcctcaagctgttgttatatct
aacacaggtgctgtggcacctcaggttgatcaaggctatcttccaaaacctctgttatca
ccagatgagagagacacagatcattctatgaaaccactctttttttcttcaaaggaagat
atccgtagttcagattgtgagagcaaaagttttgaattaactacatcttttgaagaatca
gaacgcagacaaaatgcattggggaaatgtgacgctcctctcctcgacaacaaagtacat
ttgctttttgaccaagagcatgagtcagcgtcccaaaagatggaagatgtctgtaaaagc
cccaagctgctgctgctgaaatccaatagggcagcaaacagtgtgcagagacatactcca
aggaccaagatgagacctgtaagcttgcctgtagaccggctgcttcttcttgccagttct
cctactgagagaagcagcagggatgtaggaaacgtagactcagacaagtttggcaagaac
cctgcctttgaaggactccatagaaaggacaactcaaatactactcgctccaaagttaat
ggctttgaccagcaaaatgtacagaaatcctgggacacacaatatgtacggaacaatttt
actgccaagactacgatgattgttcccagtgcctaccctgagaagggattgacagtaaac
actgggaataacagggaccatcccggcagtaaagcacatgcagagccagccagggctgca
ggagatgtgtcagagcgcaggtcctctgactcctgccccgccactgctgtcagagcaccc
agaacactgcagccccaacactggacaacattttacaaaccacctaatcccaccttcagt
gtcagggggactgaggagaaaacagcattaccctcaatagctgtacctcctgtcctggtg
catgctccccagatccatgtgacaaaatcagacccagactcagaggccacattggcctgt
cctgtgcagacaagtggtcaacctaaagagagctctgaggagcctgccctgcctgagggg
actccaacttgccagagaccacgactaaaacgaatgcagcaatttgaagaccttgaagat
gaaatcccacagtttgtgtag

DBGET integrated database retrieval system