KEGG   Mus musculus (mouse): 21415Help
Entry
21415             CDS       T01002                                 

Gene name
Tcf7l1, Tcf-3, Tcf3, bHLHb21
Definition
(RefSeq) transcription factor 7 like 1 (T cell specific, HMG box)
  KO
K04490  transcription factor 7-like 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21415 (Tcf7l1)
   04390 Hippo signaling pathway
    21415 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21415 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21415 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21415 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21415 (Tcf7l1)
   05225 Hepatocellular carcinoma
    21415 (Tcf7l1)
   05226 Gastric cancer
    21415 (Tcf7l1)
   05216 Thyroid cancer
    21415 (Tcf7l1)
   05221 Acute myeloid leukemia
    21415 (Tcf7l1)
   05217 Basal cell carcinoma
    21415 (Tcf7l1)
   05215 Prostate cancer
    21415 (Tcf7l1)
   05213 Endometrial cancer
    21415 (Tcf7l1)
   05224 Breast cancer
    21415 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    21415 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    21415 (Tcf7l1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21415 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21415 (Tcf7l1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21415 (Tcf7l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 21415
NCBI-ProteinID: NP_033358
MGI: 1202876
Ensembl: ENSMUSG00000055799
Vega: OTTMUSG00000021200
UniProt: Q9Z1J1 A1A550
Position
6 C1; 6 32.27 cM
AA seq 585 aa AA seqDB search
MPQLGGGRGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVG
QIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFPHMVAPAHPGLPTS
GIPHPAIVSPIVKQEPAAPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQLYPTWSARDNYGKKK
KRKREKQLSQTQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSPASSHGSTLDSPATPS
AALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAASNSSQMGSQPPLLS
RPLPLGSMPAALLTSPPTFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggtggtggccgcggtggcggcgccggcgggggaggcggtggctccgga
gccggggcaaccagtggaggggacgacctcggagcgaacgacgagctgatccccttccag
gacgaggggggcgaagagcaagagccgagcagcgacagcgcttcggcgcagagggatctg
gatgaggtcaagtcgtccctggtcaacgaatcggagaatcagagcagtagctcggactcc
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccgcgcgactatttc
gccgaagtgagaaggccccaggatggcgctttttttaagggacctgcgtatcctgggtac
cccttcctgatgattccagacctgagcagcccgtacctctccaacggacccctgtctcct
ggtggagcgcgcacctacctacagatgaaatggcccctcctcgatgtcccctccagtgct
acagtcaaggacacaaggtcgccatctccagcacacttgtccaacaaagttcctgttgtt
cagcaccctcatcacatgcacccgctgacacctctcatcacctacagcaacgaccacttc
tcccctgcgtcccctcccacgcatctgtccccagagatcgacccaaagacaggaatcccc
cggccccctcatccatctgagctgtcaccgtattacccactgtctccaggagctgtcgga
caaatcccccatcccctcggctggctcgtcccacagcaagggcagcccatgtactctctc
cctccgggtggtttccggcatccttaccctgccctcgccatgaacgcttcaatgtccagc
ctggtctcaagccggttcccacacatggtggctcctgcccatcctggtctgcccacctca
ggaatcccccaccctgccatcgtctcccccattgtgaagcaggagccagcagcccccagc
ctgagccctgcagtgagtgcgaaatccccagttacggtgaagaaggaagaggagaagaaa
cctcacgtgaaaaagcccctgaatgccttcatgttgtatatgaaggagatgagggccaag
gtggtggccgagtgtaccctgaaggaaagtgcagccattaaccaaatcctgggaagaaag
tggcacaacctgtcaagagaagaacaggccaaatactatgagcttgcccggaaagaacgg
cagcttcacgcgcagctctacccaacctggtcagcccgggacaactatgggaagaagaag
aagaggaagagagaaaagcagctgtcacagacacagtctcagcagcaaatccaagaggca
gagggtgctctggcctctaagagcaagaagccatgcattcagtacctgccccctgagaag
ccttgtgatagccctgcgtcttcccatggcagcacgctggactcccctgcgacgccctcc
gcagccttggcctcaccagctgcccctgcggctacccactccgagcaagcgcagcccctg
tcgctcaccaccaaaccggaggcccgggcccagctggctctccactccgctgccttcctg
tcggctaaggcggccgccagcaactccagccagatgggcagccagcccccactcctatcc
aggcccttgcccttgggctctatgcccgccgctctgctgacctctccccctactttccca
gctacgctccatgcccaccaggccctccccgtgctacaggcccagcctctttccttggtc
accaagtctgcccactaa

DBGET integrated database retrieval system