KEGG   Mus musculus (mouse): 214158
Entry
214158            CDS       T01002                                 

Gene name
Trim38, Gm23
Definition
(RefSeq) tripartite motif-containing 38
  KO
K12014  tripartite motif-containing protein 38 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    214158 (Trim38)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     214158 (Trim38)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    214158 (Trim38)
SSDB
Motif
Pfam: SPRY PRY zf-B_box zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_6 Gp-FAR-1 U-box ING PknG_rubred Exonuc_VII_L DUF4795 ZYG-11_interact zf-RING_5
Other DBs
NCBI-GeneID: 214158
NCBI-ProteinID: NP_001025106
MGI: 2684869
Ensembl: ENSMUSG00000064140
Vega: OTTMUSG00000000576
UniProt: Q5SZ99
Position
13; 13 A3.1
AA seq 471 aa
MGSDFSTVKIRKVTSCSICKAMMSHPVSINCGHSYCKSCIQSYYCNVSPKTGWKMLGCPL
CSSPFSLENLRPNKELETIIDMIKGMEEQDQDMVCEEHEEKFNRFCEDDGQLLCWRCYWE
DRHKGHTLAHVKDVYQNYKEKLQNTMTKLRELQENHEVQIHFITHQINAWKDAVEDRRQT
IKSNFKNLQSFLQEEEKFYLWRLENEEKEMLVQLEGSEANLQQTFERAQCQIQELEAKCQ
GSAQKLLQDVKNTLSRCEAMKRNPLKADPLKVHTKCNVSELYFDVKTILRRHQVSVILDP
STAHLDLALTKGGRLVTYKRCPRDLQARSSAKRFYGLPCVLGCEGFTSGRYYFEVSVENA
TSWDLGVCVENVHRGFNMKKEPESGFWTIKMSEEDGLEALTSTPTPPLHLIEKPQILGVF
LDYEAGAVSFYSVTTGSHIFTFPKASFQDTLRPFFQVYQYSPLFLPAINNQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggctcagactttagcacggtgaagataagaaaggtcacttcttgctccatctgcaag
gccatgatgtctcacccagtgagcatcaactgtggacacagctactgcaaatcctgcata
cagagctattattgcaatgtcagcccaaaaacagggtggaagatgttgggctgtcctttg
tgtagtagtccatttagcttagagaacctcaggcccaacaaggagctagaaaccataatt
gatatgatcaaggggatggaagagcaggatcaagacatggtgtgtgaggaacatgaagag
aagttcaatcgcttttgtgaagatgacggtcaactcctctgctggcgctgttattgggaa
gatcggcacaaaggtcataccttggctcatgtgaaagatgtgtaccagaactacaaggaa
aaactccagaacaccatgacaaaattgcgtgaactccaagagaatcacgaagttcagata
catttcataacacaccaaataaatgcctggaaggatgctgtagaggatcgtcggcaaaca
atcaagtcaaacttcaagaatctccagagttttctacaggaagaagagaagttttatctt
tggaggttggaaaatgaggaaaaggagatgctggtgcagctggaaggcagcgaggccaat
ctacagcagacgtttgagagagctcaatgccaaattcaggaactggaggcaaaatgtcag
ggctcagcccagaaattgctacaggacgtgaaaaacactttgagcaggtgtgaggccatg
aagcgaaacccactgaaggctgatcccctgaaggttcacactaaatgtaatgtgtctgag
ctgtacttcgatgtgaagacgatattacgacgtcaccaagtcagcgtgatcctggacccc
agcacagcccaccttgacctagctctgactaaaggtggaagattagtgacttacaaaaga
tgccccagggatcttcaggcaagatcttcagccaagaggttttatggtttaccctgtgtc
ctgggctgtgagggctttacttcggggagatattactttgaagtctctgttgagaatgca
accagttgggatttgggagtctgtgtagagaatgtgcacaggggctttaacatgaagaag
gagcctgagtctggattctggaccatcaagatgtctgaagaggacggccttgaagctctt
acttctacccctactcctccccttcatctgattgaaaagccccagattctgggagttttc
ctagactatgaggctggagctgtatcgttttacagtgtaactactggctctcatatcttc
accttccctaaggcttccttccaggatactctgaggccctttttccaggtttatcaatat
tctcctttgttcctgcctgccataaataatcaatga

DBGET integrated database retrieval system