KEGG   Mus musculus (house mouse): 21416
Entry
21416             CDS       T01002                                 
Symbol
Tcf7l2, TCF4B, TCF4E, Tcf-4, Tcf4
Name
(RefSeq) transcription factor 7 like 2, T cell specific, HMG box
  KO
K04491  transcription factor 7-like 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21416 (Tcf7l2)
   04390 Hippo signaling pathway
    21416 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21416 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21416 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21416 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21416 (Tcf7l2)
   05225 Hepatocellular carcinoma
    21416 (Tcf7l2)
   05226 Gastric cancer
    21416 (Tcf7l2)
   05216 Thyroid cancer
    21416 (Tcf7l2)
   05221 Acute myeloid leukemia
    21416 (Tcf7l2)
   05217 Basal cell carcinoma
    21416 (Tcf7l2)
   05215 Prostate cancer
    21416 (Tcf7l2)
   05213 Endometrial cancer
    21416 (Tcf7l2)
   05224 Breast cancer
    21416 (Tcf7l2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    21416 (Tcf7l2)
   05165 Human papillomavirus infection
    21416 (Tcf7l2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    21416 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    21416 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    21416 (Tcf7l2)
   04934 Cushing syndrome
    21416 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21416 (Tcf7l2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21416 (Tcf7l2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 21416
NCBI-ProteinID: NP_001136390
MGI: 1202879
Ensembl: ENSMUSG00000024985
Position
19:55730227..55922091
AA seq 459 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTYLQMKWPLLDVQAGSLQSRQTLKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL
ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQ
QGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
SQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSE
CFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgctaacgacgagctgatctcc
ttcaaagacgaaggcgagcaggaggagaagaactcggaaaactcctcggcggaaagggat
ttagccgatgtcaagtcctcgctggtcaatgaatcagagacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaacctatcttcagatgaaatggccactgcttgatgtccaagca
ggaagcctccagagcagacaaaccctcaaggatgctcgttcgccgtcgccagcacacatc
gtttcgaacaaagtaccggtggtgcaacacccccaccatgtccacccactcacgcctctc
atcacgtacagcaatgaacacttcaccccgggaaatccacctccgcacttaccagctgac
gtagaccccaaaacaggaatcccaaggcctccgcaccctccagatatctctccatattac
ccgctgtcgcccggcaccgtaggacaaatcccccatccgctaggatggttagtaccacag
caaggtcagcctgtgtacccaatcacgacaggaggattcagacacccctaccccacagcg
ctgacagtcaacgcatctatgtctaggttccctccccatatggtccctccccatcacact
ctgcacacgaccggcatccctcacccggccatcgtcacaccgacagtcaagcaggaatcc
tcccagagtgacgtcggctcactccacagctcaaagcatcaggactccaaaaaggaagaa
gagaagaagaagccccacataaagaagccccttaatgcattcatgttgtatatgaaagag
atgagagcgaaggtggtggccgaatgcacattgaaagagagtgcagccatcaaccagatt
ctcgggcgcaggtggcacgccctgtccagggaagaacaggcaaaatactacgagctggcc
cggaaggaacgacagcttcacatgcagctgtaccctggctggtctgcacgggataactat
gggaagaagaagaagagaaaaagagacaagcagccgggggaaaccaacgaacacagcgaa
tgtttcctaaatccttgcctttcgcttcctccgatcacagacctgagcgctcctaagaaa
tgccgagcgcgctttggccttgatcaacagaataactggtgcggcccctgcagtctttga

DBGET integrated database retrieval system