KEGG   Mus musculus (mouse): 21417
Entry
21417             CDS       T01002                                 

Gene name
Zeb1, 3110032K11Rik, ARE, AREB6, BZP, MEB1, N, Nil2, TCF-8, Tcf18, Tcf8, Tw, ZEB, Zfhe, Zfhep, Zfhx1, Zfhx1a, Zfx1, Zfx1a, Zfx1ha, [delta]E, [delta]EF1
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    21417 (Zeb1)
   05206 MicroRNAs in cancer
    21417 (Zeb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    21417 (Zeb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21417 (Zeb1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ZF
    21417 (Zeb1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-Di19 zf-met Homeodomain zf-C2HE zf-C2H2_6
Other DBs
NCBI-GeneID: 21417
NCBI-ProteinID: NP_035676
MGI: 1344313
Ensembl: ENSMUSG00000024238
Vega: OTTMUSG00000030924
UniProt: Q64318
Position
18 4.42 cM; 18 A1
AA seq 1117 aa
MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEESITDAADCEGGMPDD
ELPADQTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYP
EAPEEDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF
SCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLR
IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRSGLKTSQCSSPSLSTSP
GSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSSGGQ
LQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLETNQASLASKE
QEAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEIPAPT
NSCKSEKLPEDLTVKSETDKSFEGARDDSTCLLCEDCPGDLNALPELKHYDPECPAQPPP
PAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKAYYALNAQPSTEELSKIADSVNLPL
DGVKKWFEKMQAGQIPGQSPDPPSPGTGSVNIPTKTDEQPQPADGNEPQEDSTRGQSPVK
IRSSPVLPVGSAMNGSRSCTSSPSPLNLCSARNPQGYSCVAEGAQEEPQVEPLDLSLPKQ
QGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVVPPSANPINI
AIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSATVSPAVQEPPVKVIQ
PNGNQDERQDTSSEGVSTVEDQNDSDSTPPKKKTRKTENGMYACDLCDKIFQKSSSLLRH
KYEHTGKRPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHR
YSYCKRGAEDRDAMEQEDAGPEVLPEVLATEHVGARASPSQADSDERESLTREEDEDSEK
EEEEEDKEMEELQEGKECENPQGEEEEEEEEEEEEEEEEEEEVEADEAEHEAAAKTDGTV
EVGAAQQAGSLEQKASESEMESESESEQLSEEKTNEA
NT seq 3354 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaagcaaattcagattccgatgatgaagacaaactccat
attgtggaagaagaaagtattacagatgcagctgactgtgaaggtggcatgccagatgat
gaactgccagcagaccagacagtattaccaggaggcagtgacagggggggcggtgccaag
aactgctggcaagacaacgtgaaagacaacgagtgtgactcagatgcagaaaatgagcaa
aaccatgatccgaatgtggaagaatttctgcagcaacaagacaccgccgtcatttatcct
gaggcgcccgaggaagaccagcggcagggcacaccagaagccagcagtcatgatgaaaac
ggaacaccagatgcattttcccagttgctcacctgcccgtattgtgatagaggctacaag
cgctttacctctttgaaagaacacattaagtaccgccatgagaagaacgaggacaacttc
agctgctccctgtgcagttacacctttgcatacagaacccagcttgaacgtcatatgaca
tcacataagtcaggaagagagcaaagacatgtgacacagtctgggggaaaccgcaagttc
aagtgcactgaatgcgggaaggccttcaagtacaaacaccacctgaaagagcacttacgg
attcacagtggagagaagccatacgaatgcccgaactgcaagaaacggttttcccattct
ggctcctatagctcacatataagcagtaagaagtgtattagcttgatgcctgtgaatggc
aggcctagatcaggactcaagacatctcagtgttcctcgccatctctttcgacatcacca
ggcagtcccacacgcccacagatacgacagaagatagagaataaaccccttcaagaaccg
ctttctgtaaaccaaatcaaaactgaacctgtggattatgagttcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggtttttagcagtggtggccaa
ttgcaggcaaccagttctcctcagggtgtggtgcaagccgttgttctgccaacagttggt
ttggtatctcccataagtatcaacttaagtgacattcagaatgtacttaaagtggctgta
gatggtaacgtaatacgacaagtcttggagactaatcaagccagtcttgcatccaaagag
caagaagcagtgagtgcttcgcccatccagcagggtggccattctgtcatttctgccatc
agtcttcctttagttgatcaggatggaacaaccaaaatcatcatcaactacagtcttgag
cagcccagtcaacttcaggttgttccccagaatttaaagaaagaaatcccagcccctaca
aacagctgcaaaagtgagaagttaccagaagaccttactgtcaaatcagaaacggacaaa
agctttgagggggccagggatgatagcacttgccttctgtgtgaggactgcccaggggac
ctcaatgcacttccagaactaaagcactatgacccagagtgccctgctcagcctccaccc
cctgccccagccaccgagaagccagagtcctctgcttcatcagctggaaacggagatttg
tctcccagtcagccacctttaaagaaccttctgtcactcttgaaagcctactatgctctg
aacgcgcagccaagcacagaagagctctcaaagatcgccgattctgtgaacctaccgctg
gatggagttaaaaagtggtttgaaaagatgcaagctggacagattccaggacagtctcct
gaccccccttctcctggaaccgggtcagtaaacatacctacaaaaaccgatgagcagcct
caacctgcggatggaaatgagccccaggaagacagcacacgcggacagagtcctgtcaag
ataaggagctctccggttttacctgtaggatcagccatgaacggttccagaagctgcaca
tcatccccatcccctctaaacctttgctcagccaggaacccgcagggttactcttgtgtg
gcagagggtgcccaggaggagccccaagtagaacctcttgatctctcactaccaaagcaa
cagggagagttactggaaaggtcgacagtcagtagcgtttaccagaacagtgtttattct
gtccaggaagaacccttgaacttgtcttgtgcaaaaaaggaaccacaaaaggacagctgt
gttacagactcagaaccagttgtaaatgtagtcccaccaagtgccaaccccataaacatt
gctattcctacagtcactgcccagttacccacaatcgtggccattgctgaccagaacagt
gttccatgtttaagagcactggccgccaacaagcagactattctgattccccaagtggca
tatacatattcagctactgtgagccctgccgtgcaggagccgccagtgaaggtgatccag
ccaaacggaaaccaggatgaaagacaagacactagctcagaaggagtctccactgtggag
gaccagaatgactctgactccacgccacccaaaaagaaaactcggaagacagagaatgga
atgtatgcatgtgacctgtgtgacaagatatttcagaagagcagctcactgttgagacac
aaatatgagcacacaggtaagaggcctcacgagtgtggaatctgtagaaaggcatttaaa
cacaagcatcatttgattgagcacatgcggctgcactctggggaaaagccctatcaatgt
gacaagtgtggcaagcgcttctcacactccggctcctactctcaacacatgaatcaccgc
tactcctactgcaagagaggagctgaagacagagatgctatggagcaggaagacgctggg
cccgaagtcctgccggaagtcctggcgactgagcatgttggtgcccgggcgtctccctca
caggctgactcggacgagagagaaagtctgacaagggaagaagatgaagacagtgaaaag
gaggaggaggaggaagataaagagatggaagaattacaggaaggaaaggaatgtgagaac
ccacagggggaggaggaggaggaggaggaggaggaagaggaggaagaagaggaggaagag
gaggaagtggaagcggatgaagccgagcatgaggcagcagccaagactgatggtacagtg
gaggttggagctgcacagcaggcaggcagcttagagcagaaggccagcgagagcgagatg
gagagcgaaagcgagagtgagcagctgtctgaagagaagacaaatgaagcttag

DBGET integrated database retrieval system