KEGG   Mus musculus (mouse): 214240Help
Entry
214240            CDS       T01002                                 

Gene name
Disp2, AI840597, B230210L08Rik, DispB, mKIAA1742
Definition
(RefSeq) dispatched RND tramsporter family member 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Sterol-sensing MMPL
Motif
Other DBs
NCBI-GeneID: 214240
NCBI-ProteinID: NP_733481
MGI: 2388733
Ensembl: ENSMUSG00000040035
Vega: OTTMUSG00000015642
UniProt: Q8CIP5
Position
2; 2 E5
AA seq 1345 aa AA seqDB search
MAPEASPERSCSLHTCPLEDPTGAPVPPPTVSTLQAIDPTSPLTAGHFAFPRAPQDYQEG
SSLLGLGDQASLCAHVSNLSTSIDTSQHDGVWKQPSVQRHVVSVRQERTFRMPKSYSHMI
ADWPVAVIVGCLAFIFLCTLAGLLGSPPLDFSEPLLGFEPRDTEIGRRLEVWKAMQALTG
PKNLLSLSPDPEMNSSSLLSTLSPAAWGRAEESVVRTKRMVGPVEVKEEENFFCGRPEKS
HAKLVFVSTSGGSLWNLQAIHSMCRIEQEQIRSHISFGALCQRSAANECCPSWSLGNYLA
VLSNRSSCQDTTQADTDRTLALLRFCATFYHRGVLVPACVGSSQDKPPFCAQVPAKCTGS
NVVYEFLHYLLDRDFLSPQTADYQVPSLKFALLFLPIIKTSSLLDIYLDGLGDPIKVSDN
YTSISGMDLGLKPRLLKYYLAEDTMYPLIALVVIFFGMSLYLRSLFITFMSLLGVLGSLM
VAYFLYHVAFRMAYFPFVNLAALLLLSGVCVNYTLIFLDMWRLSRGQVPSGGMPHRVGRT
MHHFGYLLLVSGLTTSAAFYGSYLSRLPAVRCFALFMGTAVLVHMGLTLLWLPATVVLHE
RYLAHGCVAQAHGQRGGSDPLRLLLALHRRIRIFRKIISILSRLLFQRLLPCGVIKFRYI
WICWFAALAAGGAYIGGVSPRLQLPILLPLGGQFFRSSHPFERFDAEYRQQFLFEDLPPN
EGGNLPVVLVWGILPVDTSDPLDPRTNSSVVSDPDFSPSSPEAQEWLLALCHGAQNQSFF
GDQPEGWPTLCLVEALQQWMESPSCGRLGPDLCCGQSEFPWAPQLYLHCLKMMALEQSPD
GTRDLGLRFDTHGNLAALVLKFQTNLPYSTEYGPVHHFYTEISRWLSTEMSKAPPGLNQG
WFTSNLELYSLQHSLSTEPAVVLGLALALAFATLLLSTWNVPLSLFSVAAVAGTVLLTVG
LLVLLEWQLNTAEALFLSASVGLSVDLTINYCISYHLCPHPDRLSRVAFSLRQISRATAM
TTGVLFASGVIMLPSTILLYRKLGIIVMMVKFLGCGFASFFFQSLCCFFGPEKNCGQILW
PCAHLPWDAGTEDPDEKGRAGPPGFSEHYELQPLARRRSPSFDTSTATSKLSHRPSILSE
DLQIHDGSCCLQHAQAPVSPRDLLLDHQTVFSQCPALQTSSPYKQAGPTPQTWIRQDSQG
QKTEPLQALPEGPAHCPKSKVEELPDGLCSSASTLEGLSVSDDTCASEHSVRVPDSVGTS
PEVMNGTGHPILERGQLNGKRDTLWLALKETIYDPNMPNSHHSSLSWKGRGGPGDISPVM
LPNSQPDLPDVWLRRPSTYTSGYSS
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgaggcaagcccagagagaagctgctccctccacacctgtccccttgaagac
ccaaccggtgctccggtaccaccaccaaccgtgtccacgctccaggctatagacccgacg
agtccgttaacggctggtcattttgcctttcctcgagcgcctcaagactatcaagaagga
agttcattattaggattaggagaccaagcatctctatgtgcccatgtctccaacctcagc
acctccatagacacctctcagcatgatggggtctggaagcaaccttctgtgcagcgccat
gtggtcagtgtcaggcaggaacgcactttccggatgccgaagagctattctcatatgatt
gctgattggccagtggctgtgatcgtggggtgtctggccttcatcttcctctgtacccta
gctgggctgttgggaagcccaccacttgacttttctgagcctttactgggttttgagcct
cgagacacagagataggccgaaggttagaagtttggaaagccatgcaggccctcactggc
cccaagaatctgctttctctttccccagaccctgagatgaacagctcaagcctcctcagc
accctgagccctgcagcctggggcagggccgaggaaagtgtggtccggaccaagaggatg
gtggggcctgtggaagtcaaagaagaagagaacttcttttgtggccgccctgagaagagc
catgcaaagctggtgtttgtgtccacctctgggggaagcctgtggaacctgcaagccatc
cattccatgtgtcgcatagaacaggagcagatccgctctcacatcagttttggggctctg
tgccagcgatcagcagccaatgagtgctgccccagctggtccttgggcaactatctggcc
gtgctgtctaaccgctcctcctgccaagacactacccaagccgatacagaccgcacattg
gccctgctacggttctgtgccaccttctaccatcgtggtgtcctggtgcctgcttgtgtg
gggtctagccaggacaaacccccgttttgtgcccaagttcctgccaagtgtaccggaagc
aacgtggtctatgaattcctgcactacctgctagacagagactttctgagtccccagact
gcggattaccaggtgccctccctcaagtttgccctgctcttcctgcccattataaagacc
tcctctcttctagacatctacctggacggcctaggtgacccaattaaagtctctgacaac
tacacatctatcagtggcatggacttgggcctcaagcccagactgctgaagtattaccta
gccgaagacaccatgtatcccttgatagccctggttgtcatcttctttggcatgtccctc
tacctgcgctcactcttcatcacgttcatgtcacttctaggggtgctgggctccctaatg
gtggcctactttctttaccatgtggcattccgcatggcctacttcccctttgtcaatcta
gcggctctccttctgcttagtggtgtctgtgtcaattacacgctcatcttcttggatatg
tggcgcctcagcaggggtcaggtgccttccgggggcatgccacaccgtgtaggccgtacc
atgcaccactttggctacctgctcctggtctcaggcctcaccaccagcgcagccttctac
ggcagctacctgagccgcctgcccgcagtgcgttgctttgctcttttcatgggcactgct
gtactagtgcacatggggctcacactgctctggcttcccgccaccgtggtgctccatgag
cgctacttggctcacggctgtgtggcccaagcgcacggccagaggggtggcagcgacccc
ctgaggctgttgctggcgttgcacagacggatccgtatttttcgcaagattatttccatc
ctctcgcgcctgcttttccagcgcctgctgccctgtggtgtcattaagtttcggtacatc
tggatctgctggttcgcggcgttggcggcagggggcgcctacatcggcggcgtcagccct
cgcctgcaactgcccattctattgccacttggaggccagttcttccgttctagccatccc
tttgaacgctttgacgcagagtatcgccagcagttcctgttcgaggatctgcctccaaac
gagggcggcaacttgccagtggttctggtgtggggaatcctgccagtggacactagtgat
cccctggaccctcgcaccaacagctcagtggtaagtgatcctgacttctcgcctagcagc
ccggaggcccaggagtggctcctggctctctgccatggagcccagaatcagagcttcttt
ggagatcagccagagggctggcctacgctgtgtttagtggaagccttacagcagtggatg
gagagccctagctgtggccgcctgggtcctgatctatgctgcggacaatcagaattcccc
tgggccccccagctttacctgcactgtctcaagatgatggctctggagcaaagtcctgat
ggcacacgtgacctgggactccgcttcgatactcatggcaacctggcagctctagttcta
aagttccagaccaacttaccctacagtacagagtacggcccggtccaccacttctacact
gaaatcagccgctggttgtcaaccgagatgagcaaggcacctcctggcctcaaccagggt
tggttcaccagcaacttggagctgtacagcttgcagcatagtctaagcacagagccagct
gtcgtgcttggtctggccctggcactagcctttgccacactgctgctgagcacctggaat
gtccccctcagtctgttctctgtggcagctgtggctggcaccgtactgctcacggtgggc
ttgctggttcttcttgagtggcaactcaacactgccgaagctctctttctctctgcctct
gtgggcctctctgtagacttaaccattaactactgcatctcctatcacttgtgcccacac
ccggaccgcctgagccgtgtggccttctctttacgtcagatcagccgggccacggcgatg
acgactggagtgttgtttgcctctggtgtgatcatgctgccttccactatactgctctat
cggaagctgggcatcatcgtcatgatggtcaagttccttggctgtggctttgccagcttc
ttctttcagtccctgtgctgtttcttcgggccagaaaagaactgtggccagatcctctgg
ccctgcgcccatctgccgtgggatgccgggactgaggatcctgacgagaaggggcgagcg
gggccaccaggattctccgaacactatgagttgcagcccctggcacggcgccggagtccc
agcttcgacaccagcacagccaccagcaagctttcccatcggccttccatactctctgaa
gacctgcagatacatgatggcagctgctgcctccagcatgcccaagcccctgtctcccca
agggatctgctcctagaccaccagacagtcttcagccagtgtccagccctgcagacctcc
tctccatataagcaggctggccccaccccccaaacctggatcaggcaagattcccaggga
cagaaaactgagcccctgcaggcactgccagaaggccctgcccactgccctaagtccaaa
gtggaagagctccccgatggcctgtgctcctcagccagcaccctggagggactcagcgtc
tcagatgacacctgtgcctctgagcatagtgtccgtgtgccagattctgtgggtacctcc
ccagaagtcatgaatggcactggacaccccatacttgagcggggccagctgaatgggaag
cgcgacaccctctggctagcactgaaggagaccatctatgacccaaacatgcccaattct
caccacagcagcttatcctggaagggccgtggagggccaggcgatatcagccctgtgatg
cttcccaacagtcagccagatctcccagatgtttggctccgtaggcccagcacctacacc
tctggctacagcagctga

DBGET integrated database retrieval system