KEGG   Mus musculus (mouse): 214359
Entry
214359            CDS       T01002                                 

Gene name
Tmem51, BC003277
Definition
(RefSeq) transmembrane protein 51
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TMEM51 TMEM61 RCR WBP-1 FAM176 DUF998 SIT EphA2_TM
Other DBs
NCBI-GeneID: 214359
NCBI-ProteinID: NP_663377
MGI: 2384874
Ensembl: ENSMUSG00000040616
Vega: OTTMUSG00000010186
UniProt: Q99LG1
Position
4; 4 D3
AA seq 249 aa
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTSQGNKTEGGGGILKSK
TFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAGTVPHSQEEDSQEEEED
VSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGLDEATPTSTRAETETSPG
HAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVPPPSIEPLTPPPLYDEVQA
KAPDARPPD
NT seq 750 nt   +upstreamnt  +downstreamnt
atgatggcccaatccaaagccaacggctcacactacgcactgacggccatcggcctgggg
atgctggtcctcggggtcatcatggccatgtggaacctggttcctggtttcagccctgcg
gataagccaacgtctcagggcaacaagacagagggaggtggtggcatcctcaagagcaag
acgttttcagtggcgtacgtgctggtcggggctggcatgatgctgctgctgctagccatc
tgcctgagcatccgggacaaaaggaggatgcggcagagtgaggagctggctcgaattcag
cagcaggcaggaaccgtgccccactcccaagaagaagacagccaggaggaagaggaggat
gtctcctcacggtactacgtaccgagctacgaggaagtgatgaacacgggctacccggaa
accagggggcaggagcagaacccaagactgagcatttctctcccctcctatgagtcgcta
acggggctggacgaggcaacccccaccagcaccagggcggagacagagaccagcccaggg
catgctccggacaggcaaaactccaagctggccaaacgcctgaagccactcaaagttcga
aggattaaatccgaaaagcttcacctcaaagacttcaggatcaccctaccggacaagaac
gttcctcctccctctatcgagcctttgactcctccgcccctgtacgatgaggtccaggca
aaggcgcccgatgcccggccacccgactga

DBGET integrated database retrieval system