KEGG   Mus musculus (mouse): 214489
Entry
214489            CDS       T01002                                 

Gene name
Ccsmst1
Definition
(RefSeq) cDNA sequence BC003965
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CCSMST1
Other DBs
NCBI-GeneID: 214489
NCBI-ProteinID: NP_898973
MGI: 2670966
Ensembl: ENSMUSG00000067722
UniProt: Q6RUT7
Position
17; 17 A3.3
AA seq 136 aa
MNSVLCSRAAGAVRALRLVGWASRSLHPPPRGRSPAQPADREEEDDDPNLPIQFSGSKAT
PIRWTVEHSLGKPQQRPWWKVLPLTLTLVALVVWCYQREESGMDLWLRQVLEEEDEEEPE
GPPEELEAPALYGART
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaacagtgtcctgtgctcacgggctgcgggagcggtccgggctctgcggctcgtgggc
tgggcttcgcgaagtttgcatccgccgccccgtggccggtctccagctcagcctgcagac
agggaagaggaggacgacgaccccaacctcccgatccaattttccggcagcaaagccacc
ccgatccgctggaccgtggagcattccctggggaagccgcagcagcggccctggtggaaa
gtgctgccgctcaccctcacactcgtggctctggttgtatggtgctaccagagggaggag
agcggcatggacctgtggttgaggcaggtgttggaagaggaggacgaggaggagccggaa
ggtcctccggaggagcttgaagctccggccctctacggggctagaacgtaa

DBGET integrated database retrieval system