KEGG   Mus musculus (mouse): 214575
Entry
214575            CDS       T01002                                 

Gene name
Tdrd5, Gm103
Definition
(RefSeq) tudor domain containing 5
  KO
K18407  tudor domain-containing protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    214575 (Tdrd5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    214575 (Tdrd5)
SSDB
Motif
Pfam: OST-HTH TUDOR
Other DBs
NCBI-GeneID: 214575
NCBI-ProteinID: NP_001128213
MGI: 2684949
Ensembl: ENSMUSG00000060985
Vega: OTTMUSG00000026427
UniProt: Q5VCS6
Position
1; 1 G3
AA seq 1040 aa
MSEQERIQDCLRKEIRSLLISTKDGLTPQQLEKEYLLMVGNHLPLRILGYRSTMELVLDM
PDVVSVCPGGDGTVILKAIPDESTKGIASLVAKQRRSHKVRNSMPKGRPSICSGRVPYRG
RVPPILPAVVKSELKDLLALSPVLLSDFEKAFARRFGRSFQYMQYGFLSMFEVLNAASDV
ISVEQTRAGSLLTLKKSVSEDKQRGWPAGKVFTQPFRMKQQGSYSTGFPVMKAHFSQPIS
NMEPPKQVLSMAKTPTFNSVEASRLNHTEKLNQLESTFKSVIAQIGPGGTVDPELKRKIQ
FVVSKFPQGLFISKLLGEFELTFKEQLSPKQLGFLNVTELVGALSDILRVEFSEERQDLL
VFDADLKPLPSGGPLSSVRNSCLVQPDKKTEANPWTSSLSRNSLSTVAVKKTTWDCPLKN
QKEPEQKIYKKPNLVVKPLQLQVETNKPQLSLSVANHDIPPDAVRAKKLCRLPPLDTSTL
VGVFVEYIISPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYIMPEYFIQPGHLC
CVKISEDKWWYRVIIHRILGKKEVEVFYPDFGNIGTVQKSSLRFLKCCYTKLPAQAIPCS
LAWVRPAEEHWTARAILHFQKLCGLKPLVGVVDEYIDGILNIFLCDTSSNEDVYFHHVLR
TEGHAIVCRENAPSKGFRDFNPPALYTNASSAGDMVLTDLGHPAQQHYLNEDQEILQQAQ
QDINDGKCISYLKSAPKELLKDSKLSSLKTHKSCEEDPRWSILQPKDLKEENEDEVPTGM
PCLESVTIGDDVWDENWLPLQAKMGKAGSPASQLFTSNLVGKKQYQTGGEMAQKDWCFST
SKDIWDDSWQPLGLANDVKGGIHTPEGPIAQEKNTSTTRIQQQPDLQYPLDSSTLPKLEE
FYISLIKSQQSAERSQSEPASIQTHAGRAASKALSSTPAVGDSPENHSGSVESSPGSLKK
EDVSNSRAEATAKDKSQGAIDQLSFILSPQHQISQKLYIPRSTATAVLGAAARLATSRSL
LHWYPSVKGGKLEAERDGVK
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgtctgaacaagagcgtatacaggactgtctgaggaaagagataaggtcccttcttatt
tccactaaggatggtttgactccacaacagttggaaaaggagtaccttttgatggttggc
aaccatctcccgctccgaatccttggatatcggtccactatggaactggtgttggatatg
cccgatgtggttagtgtctgccccggtggggatggtaccgtaatactgaaagccattcca
gacgaatccaccaaaggaatagcaagtttggttgcaaagcagagaaggagccataaggtc
cgaaactccatgccaaagggaagacccagcatatgctctggccgggtgccttaccgagga
agggtgcccccaattcttccagctgtagtgaagagtgagttgaaagaccttttggcattg
tctcccgttctcctttctgactttgaaaaggcatttgccaggcgttttggacgatcattt
cagtatatgcagtatggattcctctctatgtttgaagtgctgaatgcagcttcggatgtc
atttctgtagagcagaccagagcaggttctctgttgacactaaaaaagagtgtatcagag
gacaagcagagaggatggccagcaggtaaagtttttactcagccatttagaatgaaacaa
caggggtcatattctacaggattcccagtaatgaaggcacacttttcacaacccatttca
aatatggagccccccaaacaagtactgagcatggcgaagacacccacgtttaattctgtg
gaggcttcaaggctgaaccacactgaaaaattaaatcagttggagagcacattcaaatcc
gtgattgcacagattggacctggagggactgttgatcctgagctaaagcgcaagatacaa
tttgtcgtgtctaagtttccacaaggtttgtttatttctaaactgcttggagaatttgag
ctaacttttaaagagcaactttcaccaaaacaattagggttcttaaacgtgacagaactt
gttggcgctcttagtgacattctccgagttgagttcagtgaagaaaggcaagacttgctc
gtgtttgatgctgacctgaagcctctgccgtctggtggaccgctttcatcagtcagaaat
tcgtgtttagttcaaccagacaagaaaacagaagctaacccttggacttccagtctctcc
agaaattcactatccactgtagcagttaagaagaccacgtgggattgccctttgaagaac
cagaaggagccagaacagaagatatacaagaagcctaatctggtggtcaagcctctgcag
ctgcaggtagaaacaaacaaaccgcagctcagcctgtcagtggcaaaccacgatatccca
ccagacgctgtgcgtgccaagaaattgtgcagacttcctccattagataccagcaccctt
gtgggggtcttcgtggagtatataatctcccctagtcagttctacatccggatctacagc
agagattcctcagaactacttgaagacatgatgattgaaatgcgacgctgctactccaac
cagctggtctctgaccggtacattatgccagaatattttatacaaccaggacatctctgt
tgtgtaaagatctctgaggacaagtggtggtaccgggttattatccatcggatccttggg
aaaaaggaagtggaagtgttctacccagatttcggaaatatcggaactgtgcagaagtcc
tcgctgaggttcctcaaatgctgctacacaaagcttccagctcaggctatcccttgctct
ttggcgtgggtgaggcccgcagaggaacactggacagccagagctattttgcacttccag
aagctgtgtggtttgaagccattggtgggggtggtggatgagtatatagacggaatcctt
aatatttttctttgtgatacgtcctcaaatgaagatgtgtattttcatcatgtcttgagg
acagaaggccatgctattgtatgccgagaaaatgccccatccaagggcttcagggatttc
aacccaccagctctgtacactaacgccagctcagcgggcgacatggtcctgacagacctg
gggcatcctgctcagcagcactatttaaatgaagaccaggagatactgcagcaagcccag
caagatattaatgatggaaagtgtataagttaccttaaatctgcgcccaaggaattatta
aaggattctaaattgagctcattgaaaacacataagagctgtgaagaggacccacggtgg
tccatcctgcagcccaaggatctgaaggaagaaaatgaggatgaggtccctactggaatg
ccatgcctggagtcagtgaccataggtgacgatgtttgggatgagaactggctccctcta
caggccaaaatggggaaggcagggagtcctgcctcccagctgtttacttcaaaccttgtt
gggaagaaacaatatcagacaggtggagaaatggcacaaaaggactggtgtttttctaca
tctaaagatatatgggatgattcctggcagcccttaggccttgcgaatgatgtgaaagga
ggaattcacacaccagaagggcccattgctcaagaaaaaaataccagcacaacccgaatt
caacagcagccagatttacagtatcctttggattcttccacactgcccaaactggaagag
ttctacatctctctgatcaagtctcagcagtccgcagagaggagccagtctgaacctgcc
agcattcagactcatgccggacgggcagcctcaaaagcactcagttcaacccctgcagtg
ggtgactctccagaaaaccactctggctctgtggaaagctctccagggagcctaaagaaa
gaagatgtttctaatagccgtgctgaagccacggccaaggacaagagtcagggagccata
gaccagctctctttcattttgtccccccagcaccagatttctcagaagctctacatccct
cgaagtacagccacagctgtcttgggagctgcggcacggttagccacgtccaggagcctc
ctgcactggtaccccagtgtgaaaggagggaagcttgaggcagagagagatggagtgaag
taa

DBGET integrated database retrieval system