KEGG   Mus musculus (mouse): 214601
Entry
214601            CDS       T01002                                 

Gene name
Slc10a3, DXHXS253, DXHXS253E, DXS253E, DXS253Eh, DXSmhG2, DXSmhG28, P, P3
Definition
(RefSeq) solute carrier family 10 (sodium/bile acid cotransporter family), member 3
  KO
K14343  solute carrier family 10 (sodium/bile acid cotransporter), member 3/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    214601 (Slc10a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   214601 (Slc10a3)
SSDB
Motif
Pfam: SBF
Other DBs
NCBI-GeneID: 214601
NCBI-ProteinID: NP_001243033
MGI: 95048
Ensembl: ENSMUSG00000032806
Vega: OTTMUSG00000017664
UniProt: P21129 A0A158SIT6
Position
X A7.3; X 38.0 cM
AA seq 473 aa
MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGH
YLSIGDGSVTEFDFPEKSEGIIVISSQYTGQTNGTGPSPILKVISLDTEVLTIKNVSAIT
WSSGGGFVVGIHSGLAGLAPLHLQLMDFYEAPPLLIEERRDFCIRVSPAEDLPSALNTNL
GHFSENPILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQPMLLGLLGQFLVMPFYAFLM
AKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSA
IYSYLLSIHETLHVPISKILGTLLFIAIPIAAGVVIKSKLPKFSELLLQVIKPFSFILLL
GGLFLAYHMGVFILVGVRLPIVLVGFTVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQ
NSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGQFIYSILFPVP
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggtggtcaagaaaagcagaggtagctcccagcagttgcctggcctgggaggacagggt
ggttgtacaggttttgtaggcatgcttggaactgccctgctgttcatcagcctaccatgg
ggagctcaagtgatggccagtgccaacatcagcactgctctgggccacacaagtggtcac
tatttgagtattggggatggctcagtgacagaatttgatttccctgagaagagtgagggt
atcattgtgatctctagccaatacactggacagaccaatgggacaggccccagccccata
cttaaggttatatccctggacacagaggtgctgaccattaagaatgtgagtgccataacc
tggagcagtggaggtggctttgtggtaggcatccactcaggtctagctgggctggcccca
ctccacctccagctcatggatttctatgaggccccacccctgctgatcgaagaacggaga
gatttctgcatcagggtgtcacctgctgaagacctcccttctgctctcaacaccaacttg
ggccacttctcagagaacccaatactctacttgcttctgcctcttatctttgtcaacaag
tgttcatttggttgcaaagtggaacttgaagttttgaaggagctcctacagagcccccaa
cccatgctgttgggcctcttgggccagtttctggtcatgcctttctatgctttcctgatg
gccaaagtcttcatgctacccaaggccttagctctgggcctcatcattacctgctcatca
cctggtggtggagggagctacctcttcagtctcctccttggaggagatgtcaccctggcc
atctccatgactttcatctcaacagtagctgccactggtttcctaccactctcatcagcc
atctacagctaccttctcagcatccatgaaacactccacgtgcccatctccaagatattg
gggaccctgctgtttatcgccatccccatagcagcgggtgtggtgatcaaatctaagctc
cccaagttctctgaactactgttacaggtcatcaagcccttcagctttatacttctcctg
ggtggcctgttcctggcctaccacatgggggtcttcatcctagtgggagtcaggttaccc
attgtactggtgggtttcacagtgcctcttgttggcctcttggtgggctacagcctggcc
atctgcctgaagctgccagtggctcagcgacgaacagtcagcattgaggtaggggtgcaa
aacagcctgctagccttagccatgctacagctgtctctgcgccgccttcaagcagactat
gcctctcaggcccctttcattgtggcactgagtggtacctccgagatgttggctttggtt
attggccagttcatctatagcatcttgtttcctgttccctga

DBGET integrated database retrieval system