KEGG   Mus musculus (mouse): 214663
Entry
214663            CDS       T01002                                 

Gene name
Slc25a29, C030003J19Rik, CA, CACL, mCA, mCACL
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    214663 (Slc25a29)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    214663 (Slc25a29)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   214663 (Slc25a29)
SSDB
Motif
Pfam: Mito_carr Tim17
Other DBs
NCBI-GeneID: 214663
NCBI-ProteinID: NP_851845
MGI: 2444911
Ensembl: ENSMUSG00000021265
Vega: OTTMUSG00000027570
UniProt: Q8BL03
Position
12; 12 F1
AA seq 306 aa
MALDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGQDSPLNQFLAGAAAGAIQCVICCPMELAKTRL
QLQAVGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMG
CEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQ
AEGWQVFTRGLASTLLRAFPVNAATFATVTVVLTYTRGEEAQVDSEAALGTSPTPAGSAL
AQPSSL
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgctcgacttcctggctggatgcgccggaggtgtggcaggtgtgatcgtgggacac
ccttttgacatagtcaaggtgcggctgcaagttcagagcacagagaagcctcagtacaga
gggacgctgcactgcttccagtccatcatcaagcaggagagtgtgctgggcctgtataaa
ggcctgggctcgccactaatgggactcaccttcatcaatgcactggtgtttggggtgcaa
ggtaacaccctccgggccctgggccaagactcaccactcaatcagttcctggccggtgca
gcagcaggcgccattcagtgtgtcatctgctgccccatggaactggccaagacgaggctg
cagctccaggccgtgggtcctgcccgtacctacaagggctccctggactgcctggtgcag
atttaccggcatgagggcctgcgcggcatcaatcgaggcatggtgtccacacttctgcgg
gagacgccaagctttggcgtctacttcctcacctatgatgtaatgacccgcgccatgggc
tgcgagccaggtgaccgcctgctggtgcctaagctgctgctggcgggtggcacgtcgggg
atcacatcctggctctccacttatcccatggacgtggttaagtcacgactgcaagccgac
gggctacaaggaacccctcgctaccgcggcatcgtcgactgcatgcggcagagctaccag
gccgagggctggcaagtcttcacgcgagggctggcctccacgctgctccgtgccttcccg
gtcaatgctgccacctttgccacagtcactgtggtgcttacatatacccggggcgaggag
gctcaggtagacagtgaggcagctctgggcacctctcccactcctgctgggtctgccctg
gcccagccttccagtctgtga

DBGET integrated database retrieval system