KEGG   Mus musculus (house mouse): 214669
Entry
214669            CDS       T01002                                 
Symbol
L3mbtl2, 4732493N06Rik, M4mbt
Name
(RefSeq) L3MBTL2 polycomb repressive complex 1 subunit
  KO
K24387  lethal(3)malignant brain tumor-like protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    214669 (L3mbtl2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    214669 (L3mbtl2)
SSDB
Motif
Pfam: MBT
Other DBs
NCBI-GeneID: 214669
NCBI-ProteinID: NP_666105
MGI: 2443584
Ensembl: ENSMUSG00000022394
UniProt: P59178
Position
15:81548090..81572516
AA seq 703 aa
MEKPRGTEEAPSSEPMEEEEEDDLDLFGGYDSFRSYNSSAGSESSSYLEESSEAENEDRE
AGELPTSPLHLFSSANNRSLDGSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSYSS
NSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHAQGTGQLADGTPTGQDALVLGFD
WGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVLPSRVYWIATVIQAAG
YRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKSYLMKR
LVGSRTLPADFHIKMVESMKYPFRQGMRLEVVDKTQVSRTRMAVVDTVIGGRLRLLYEDG
DSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSDRRCDMSHHPTFRKIYCDAVPYLFKKVRA
VYTEGGWFEEGMKLEAIDPLNLGSICVATICKVLLDGYLMICVDGGPSTDGSDWFCYHAS
SHAIFPATFCQKNDIELTPPKGYETQPFAWETYLEKTKSKAAPARLFNMDCPNHGFKVGM
KLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQ
LQPPVSAEPNTPQKGKDTTKKKKKQFGKKRKRIPSAKTRPLRQGSKKPLLEDNLEALGVS
EPVPDDIIAVCVKEEHQDISSLDRSPSPQLPLPIESIKQERNN
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggagaaaccgcggggcactgaggaggcgccatcttcagagccaatggaagaggaggag
gaagatgacttggatctctttgggggctacgacagcttccggagttacaacagcagtgcg
ggcagcgagagcagctcctacttggaggagtcaagtgaagcagagaacgaggaccgggaa
gcaggggagctgcccacctcacctctccatctgttcagctctgcgaacaaccgctccttg
gatggaagtggttctgagccagctgtctgtgagatgtgtggtatcgtgggcacaagagaa
gctttcttctcaaagaccaagaggttctgcagcgtctcgtgttccaggagctactcctcc
aactccaagaaagccagtatcctggctagactacagggaaagccacccaccaagaaagcc
aaagtcctgcacaaggcagcctggtctgccaaaattggagcctttctccatgcccaggga
acaggacaactagcagatgggacacccactggacaagatgctctggtcctgggcttcgac
tggggcaagttcctgaaggatcatagttacaaggctgctcctgtcagctgctttaaacat
gtacccctctatgaccagtgggaagacgtcatgaaggggatgaaggtggaagtgctcaac
agcgatgctgtgctccccagccgggtgtactggatcgccactgtcatccaggcagctggg
taccgggtgctgctccgatatgaaggctttgaaaatgacgccagtcatgacttctggtgc
aacttgggaactgtggatgtccaccccattgggtggtgtgccatcaacagcaagatcctg
gtacctccacggaccatccatgccaagtttactgactggaagagctacctcatgaagcgg
ttggtgggttccaggacacttcctgcagacttccatatcaagatggtggaaagcatgaag
taccctttccgacagggcatgcgcttagaggttgtagacaagactcaggtgtcacgtacc
cgcatggccgtggtggacacagtaatcgggggtcgcctccggctcctctatgaggatggt
gacagtgatgacgacttctggtgccatatgtggagtcccctgatccacccagtgggttgg
tcccggcgtgttggccacggcatcaagatgtcagacagacgatgtgacatgtctcatcac
cccaccttccggaaaatctactgtgatgctgtaccttacctcttcaagaaggtccgcgct
gtctacacagaaggtggctggttcgaggaaggaatgaaactagaggccattgaccctctg
aatctgggcagtatctgtgtagcaaccatctgcaaggtgctcttggatggttacctgatg
atctgtgtggatggggggccctccacggatggctccgattggttctgctaccacgcctcc
tcccatgccatcttcccagccaccttctgccaaaagaatgacattgagctcacaccccca
aaagggtatgagacacagccttttgcctgggagacctacttagagaagaccaagtcaaaa
gctgctccagcaagactctttaacatggactgccccaaccatggcttcaaggtgggcatg
aagctggaggctgtggacctgatggagccccggctcatctgtgtggccactgtgaagcgg
gtggtgcatcggctcctcagcatccacttcgacggctgggacaatgagtatgatcagtgg
gtggactgcgaatccccggacatctaccctgtcggctggtgtgagctcaccggctaccag
ctccagccgcctgtgtccgcagaaccaaacacacctcagaaaggcaaggacaccacaaag
aagaagaagaaacagtttgggaagaaaaggaaaagaatcccatcagccaagactcggccc
ctcagacagggctccaagaaacccttactggaggacaaccttgaggctttgggggtctcg
gaaccagttcctgatgacattatcgctgtgtgtgtgaaggaggagcaccaggacatttcc
tcgcttgacaggtcgcccagtccacagctgcctcttcccattgagagcatcaagcaggag
aggaacaactga

DBGET integrated database retrieval system