KEGG   Mus musculus (mouse): 214804
Entry
214804            CDS       T01002                                 

Gene name
Syde2, C430017H16Rik
Definition
(RefSeq) synapse defective 1, Rho GTPase, homolog 2 (C. elegans)
  KO
K20655  Rho GTPase-activating protein SYDE
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    214804 (Syde2)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    214804 (Syde2)
SSDB
Motif
Pfam: RhoGAP
Other DBs
NCBI-GeneID: 214804
NCBI-ProteinID: NP_001159536
MGI: 3036264
Ensembl: ENSMUSG00000036863
Vega: OTTMUSG00000055198
UniProt: E9PUP1 Q8BKW6
Position
3; 3 H2
AA seq 1314 aa
MAEPLRRTLGRLRERHAPGALGLHADSVAASLSEGRSPPHELAGPGMERPAWGTEQPGAR
VPWSRGAQEAAALGRALARASPGAWGSGDDDGEDEGADYYENLPAGCAPEGAEALRASPS
RAPGSSPGMEGGRLETGRLQTQLREAYYLLIQAMHDLPPDSGTRRGGPAGARAQGQQPPL
PRGAAVRPACSLRGGDRPPQQVSPPRSPPTESREGRPPSPRIQLSSCRSLESLRVSRRPP
LLQRWASDSCIRCGAHRDRDEPQPRGGGMDGWSPGSHRAATSAALLPPICHDPSGSSGRP
FKDPVGTSVISSSQEDHPEDLPLKPPAVTVKKLQKWMYKGRLLSLGMKGRDRGTAPKVPG
AQTTSPNLGSWKVHENHVLSVTTDQRITLTDLFENVYGSPLKKREPEDVRGPAELRGHQP
LNNITVSKKRNWLYQSTLRSQSLDESKRSQDRRYFSLSPVSPPKHWVSHRPHCTHAVCNA
ARATLSRNGSSAFSEDNDADDEGEIWYNPIPEDDSLGIAHVLSLEEANTAALKLPVSMLS
ARDLMKAEPPSEDRGDVQTSQSNGINSADSMHSTEIMQHCKQRLGHRTQESPTAEDSPVL
KSASTGPGIIVSTNRTELRAMEPSSPSPSPGKKGSSITWSLPDKIKSPRTVRKLSMKMKR
LPEFSRKLGARGALHYVNNPDSTPPLSKWNCREIPQGVTLTSGNTTRNVISRYHLDTTVS
SRHSYRKKPLGSSKYSCKGGYLSDGDSPELRTRSSKHGSEHKLGKGRETVPSSCSKNELD
IGAFRHYSFADQPKCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALL
TCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPALFRVTKTHQLA
VKLEPRGLIYVKVTLMEQWENSLHGLDKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCI
VEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRE
LPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLD
HLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEV
LHYLLQLWPVQRLTVKEPRDSLCLEQSSSLNYLRRKKERPCVLNLSGPDSSGVLRTRQAR
LDSPLSNRYAGDWSSCGESYSLNTRGNVKNLDYDDGPLEGGESRQYSKTAGAEVMTAQRI
PMSGGCTFQTYLTVQTIESTVDQKANLRDLQESIDTLIGNLERELNKNKLNMSV
NT seq 3945 nt   +upstreamnt  +downstreamnt
atggcggagcccctgcggaggacgctcggccggctccgagagcggcacgctcccggcgcg
ctcgggctgcacgcggactccgtggcggcctcgctctccgagggacgctcgccgccccac
gagctcgcgggccccggtatggagcggcccgcatgggggaccgagcagccgggcgcgcgg
gtgccatggtctcgcggggcgcaggaggccgccgctctgggccgcgcgcttgctcgcgcc
tccccaggcgcctggggcagcggcgacgacgacggggaggacgagggcgccgactactac
gagaacctgccggcgggctgcgcgcccgagggggcggaggcgctgcgggcctcgccttcc
cgagcgccgggctcctccccggggatggagggcggccgcctggagacgggcaggctgcag
acccagttgcgagaggcctattatctgctgatccaggccatgcacgacctaccccctgac
tcgggcacgcggcggggcggacccgcgggagcccgggctcagggccagcagccgcctctc
ccccgcggcgcagccgtgcgcccagcctgcagcctccgaggcggcgaccgccctccgcag
caggtgtccccgccccggtcgcctccgacggagtcgagagagggacggcctcccagtcct
cggatacaactgtccagttgcagaagtctcgagagcctccgcgtgagccggcggccgcct
ctgctccagcggtgggcgagcgacagctgcatcaggtgcggtgcgcaccgggacagggac
gagccccagccacgtggaggtgggatggacggctggagcccgggcagccacagggctgct
acgtccgccgctctcctgcctcccatctgccatgaccccagcgggtcctcgggacgaccc
tttaaggatcctgtggggacctctgtgatatccagcagccaagaggaccatccggaggat
cttcccctcaagccacctgcggtgactgtcaagaaactgcagaagtggatgtacaaagga
cgtctgctgtccctggggatgaagggtcgcgatcgcgggacagcacccaaagttcccgga
gcgcagacaacctctccaaatttgggcagttggaaagtgcatgaaaaccacgtcctctcg
gtgacaacggaccaaagaatcacactgacagacttatttgagaatgtctatggctctcca
ctgaagaaacgagaacctgaagatgtaaggggtcccgccgagcttagaggtcaccagccc
cttaacaacatcacagtttcaaagaagcgcaattggctgtatcagagcaccctgaggtct
cagagtctggacgagagcaagcgaagccaggacagacgctatttctccctctctcctgtg
tctccacccaagcattgggtatcccacaggccgcactgcacacatgcggtgtgtaatgct
gccagggctacgttgtccagaaacggctcttcagcctttagcgaggacaatgatgcggac
gatgaaggagaaatatggtacaatcccatccctgaggatgacagcttgggcatagcacac
gtcttgagtcttgaggaggcaaacaccgccgccctgaagcttcctgtgagcatgttgtct
gccagagatctgatgaaggcggagcctcctagtgaagacagaggggacgtgcagacctca
cagtcaaatggaattaattctgcagattccatgcattctacagaaattatgcagcactgc
aaacaaaggttagggcacaggacacaagaaagcccgacggcagaggatagccctgtgttg
aaatctgcttctacaggtcccgggatcatagtctctacaaataggactgaactgagagcg
atggagccgtcttctccaagccccagtcctgggaagaaaggcagttccattacttggtct
ttaccagataaaataaagtctccacgcactgtgaggaaactttctatgaaaatgaaaagg
ttgccagaattcagccgaaagctgggggccaggggagctttgcactatgtgaataatccg
gatagcacccctcctttgtctaaatggaactgtcgagaaattcctcagggtgtcactctg
acttccgggaacaccaccaggaacgtgataagccggtaccatcttgataccaccgtatcc
tctcggcacagctaccggaagaaaccccttgggagctcgaagtattcctgcaagggtggg
tacctcagcgacggagactcacccgaactgagaactagatctagcaagcatggatcggag
cacaaacttgggaaagggagagaaactgtcccaagcagttgtagcaaaaatgaactagac
atcggtgccttcagacattacagctttgcggatcaacccaaatgctcgcagtacatatcc
ggcctcatgagcgtacacttctatggagctgagggtttaaaaccgccccggatagattcg
aaagatgtgttttgtgccattcaggtagactcagtgaacaaagccagaacggccctgctc
acctgtcggacgaccttcttagacatggaccacacgttcaacatagagattgaaaatgcg
cagcatctgaagctggtggtgttcagctgggagcccacgccgaggaggaaccgcgtgtgc
tgtcatggcacagtcgtcctgcccgctttattcagagttacaaaaacgcatcagctggct
gtcaagctggagcccagaggccttatttacgtcaaggtgaccctgatggaacagtgggag
aattctctgcacggcctggataagaaccgcgaagcggtgatgttcggagtcgacattcaa
aaagttgtagagaaagaaaacgtaggcttgatggtgccgctgctgatacagaaatgcatc
gtggagattgaaaagaggggttgtcaggttgtaggcctgtatcgattgtgtggttcagcg
gcggtgaagaaagagcttcgagaggcttttgagaaggacagcaagactgttggtctgtgt
gaaaaccagtacccagatataaatgtaataacaggggttcttaaggactacttgagagaa
ctcccttctcccctaataaccaagcagctgtatgaggctgtgttggatgccatggcgaag
agtcctttgaaaatgtcgtccagtggttgtgagaacgagcccagtgactccaggctcact
gtggacctcctggattgcctgccggacgttgagaaggcaaccctgaagatgttgttggat
catctgaaactggtggcctcctaccacgaagtgaataagatgacctgccagaatttggct
gtgtgctttggaccagtgttgcttaaccagaggcaagaggcttcaacccacaacaacaga
gtcttcaccgattctgaagagcttgccagtgctttggattttaaaaaacacatcgaggtt
cttcattacttgctccagctctggccagtgcaacgcttaactgtcaaagaacccagagac
agtttgtgcctggagcagtcgtcttctctgaattacttgaggcgaaagaaagagcggccg
tgtgtgttaaacctgagcggtccggattcatcaggggtgctgaggacaaggcaggcccga
ttagacagtccactcagcaaccgctatgcaggagactggagcagctgtggggagagctac
tctttaaatacaagaggaaatgtcaagaatttggactatgatgacggccccttagaaggt
ggagaaagtagacagtatagcaaaacagccggagcggaagtcatgaccgcacaacgaatc
cccatgtcaggggggtgcacgtttcagacgtacttgacggtacagaccattgaatccacg
gtggatcagaaagctaacctcagagatttgcaagagagcattgatactttgattggcaat
ctggaacgtgagctcaacaaaaacaagctgaacatgagtgtttga

DBGET integrated database retrieval system