KEGG   Mus musculus (mouse): 214897
Entry
214897            CDS       T01002                                 

Gene name
Csnk1g1, 9130020E21Rik
Definition
(RefSeq) casein kinase 1, gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    214897 (Csnk1g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    214897 (Csnk1g1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     214897 (Csnk1g1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   214897 (Csnk1g1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 214897
NCBI-ProteinID: NP_775277
MGI: 2660884
Ensembl: ENSMUSG00000032384
Vega: OTTMUSG00000029794
UniProt: Q8BTH8 Q6P2B2
Position
9; 9 C
AA seq 459 aa
MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDP
TGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQRHK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggaccattctaatagggaaaaggatgatagacaacggacaactaaaaccatggcacaa
aggaatacacactgttcgagaccatctggcacttcaacatcctctggggttctcatggtg
ggacccaacttcagggttggcaagaagatagggtgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagccattaaactggaaccaataaaatcacgt
gctccacaacttcatttagagtacaggttttataaacagcttggcagtgcaggtgaaggc
ctcccacaggtttattactttggaccatgtgggaagtacaatgccatggtgctggaactc
cttggccctagcttggaagacttgtttgacctctgtgaccgaacgtttactttgaagacg
gtgttaatgatagccatccagttgctttctcgaatggagtatgtacactcaaagaatctt
atttaccgagatgtcaaaccagagaacttcttgattggccgacaaggcaataagaaagag
catgtaatacacattatagattttggactggccaaggaatatgttgatcctgaaaccaaa
aaacacataccttacagagagcacaaaagtttgactggaactgcgagatacatgtctatc
aacacacatctaggcaaagagcaaagccggcgagatgatttggaagccttaggccatatg
ttcatgtacttcctccgaggcagcctaccctggcaaggactcaaggctgatacattaaaa
gagagatatcaaaaaatcggtgataccaaaaggaatactcccatcgaagctctctgtgag
aactttccagaggagatggcaacctaccttcgatatgtcaggcgattagacttctttgaa
aaacctgattatgagtatttacggaccctcttcacagatctgtttgaacggaaaggctat
acctttgactatgcctatgattgggttggaaggcctattcctactccagtaggatcagtt
catgtagattctggtgcatctgcaataactcgagaaagccacacacacagggatcggcca
tcacaacaacagcctcttagaaatcagactacatcatcagagcgccgaggagagtgggaa
atccagcccagccggcagaccaatacctcatacctgacgtctcacttggccgcagaccgc
catgggggttcagtacaggtggttagctcaaccaatggagagctgaatgtcgatgacccc
actggagctcactccaatgcaccaatcacagctcatgccgaagtggaggtagtggaggaa
gctaagtgctgctgtttctttaagaggaaaaggaagaagacagcccagcgacacaagtga

DBGET integrated database retrieval system