KEGG   Mus musculus (mouse): 214917
Entry
214917            CDS       T01002                                 

Gene name
Antkmt, ANT-KMT, Fam173a
Definition
(RefSeq) adenine nucleotide translocase lysine methyltransferase
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Methyltransf_23 PrmA DOT1
Other DBs
NCBI-GeneID: 214917
NCBI-ProteinID: NP_663385
MGI: 2384888
Ensembl: ENSMUSG00000057411
UniProt: Q501J2
Position
17; 17 A3.3
AA seq 229 aa
MDQDDPAEALTELREKRLGLLEIVQAAAGSGLAVYTIWALLLQPGFRRVPLRLQVPYVGA
SARQVENVLSLLRGRPGKMVDLGSGDGRIVLAAHQCGLRPAMGYELNPWLVGLARLHAWR
AGCSASVCYHRKDLWKVSLRDCHNVSVFLAPSVLQLLEDKLQAELPVGARVVSGRFPLPT
WQPVAVVGEGTDRVWAYDVHGSGPTVSSCGVPIKAIPESSSTLVPRAPV
NT seq 690 nt   +upstreamnt  +downstreamnt
atggatcaggacgacccagccgaagcgttgactgagctacgcgagaagcggctgggcttg
ctggagatagtgcaagcggcggcaggctcgggattggccgtctatactatatgggcgctg
ctgctgcagccgggcttccgccgggtgcctctgaggctgcaggtgccctacgttggcgcg
agtgcccggcaggttgagaacgtgctgtcactgttgcgaggccgccctggaaaaatggtg
gatctaggctctggtgatggcaggatcgtgctggcggcccaccaatgtggtctccgtcca
gctatgggatatgagctgaacccgtggcttgtgggacttgcacggctgcatgcctggaga
gccggttgttctgcgagtgtctgctaccatcgaaaagatctctggaaggtgagcctcagg
gactgtcacaacgtgtctgtgttcctggctcccagtgtgctccaactgctggaggacaaa
ctgcaagcagagctccctgtgggggcccgtgtggtatctggacgattcccccttcccacc
tggcagcctgtagctgtggtgggcgagggcactgacagagtttgggcctatgatgtccat
ggttctgggccaactgtgtcttcttgtggggtgcccatcaaggccatcccagagtccagt
tctaccttagtccctagagcccctgtttga

DBGET integrated database retrieval system