KEGG   Mus musculus (mouse): 214987
Entry
214987            CDS       T01002                                 

Symbol
Chtf8, 5830457O10Rik, Ctf8, Derpc
Name
(RefSeq) CTF8, chromosome transmission fidelity factor 8
  KO
K11270  chromosome transmission fidelity protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    214987 (Chtf8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    214987 (Chtf8)
SSDB
Motif
Pfam: Ctf8
Other DBs
NCBI-GeneID: 214987
NCBI-ProteinID: NP_663387
MGI: 2443370
Ensembl: ENSMUSG00000046691
Vega: OTTMUSG00000042130
UniProt: P0CG15 P0CG14
Position
8; 8 D3
AA seq 121 aa
MVQIVISSTGAEGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILY
GKTIHLEKPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKPIITNVPKK
V
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtgcaaattgttatttccagtacgggggctgaaggcctggcagaatgggtgctgatg
gagctacagggggagatcgaggctcgctacagcaccggattagctggaaacctcctggga
gacctacattacaccactgagggaatccctgtgctgatcgtgggccatcatatcctgtat
gggaaaaccatccacctggagaaaccttttgcagtccttgtcaaacacactcctgggaag
caggactgtgatgagcccggtcgagggactggcacccagtacttggtgacagcactcatc
aaaaacaagatccttttcaaaactcgccccaagcctattatcaccaacgtccccaagaaa
gtatga

DBGET integrated database retrieval system