KEGG   Mus musculus (mouse): 215008
Entry
215008            CDS       T01002                                 

Gene name
Vezt, A630071D13, A630071D13Rik, AI848282
Definition
(RefSeq) vezatin, adherens junctions transmembrane protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Vezatin ATPase_2
Other DBs
NCBI-GeneID: 215008
NCBI-ProteinID: NP_766126
MGI: 2143698
Ensembl: ENSMUSG00000036099
Vega: OTTMUSG00000030972
UniProt: Q3ZK22
Position
10; 10 C2
AA seq 780 aa
MTPEFDEEVVFENSPLYQYLQDLGHTDFEICSSSSPKPEKCLTTEGPQPPPTRVLQRQGI
LLKLTETIKSWTFSSQHSKKDDLLHKLDTGFRLDSLHTILQQEVLLQEDVELLELLDASI
LSAGQPQQESGHLPTLCSLATPNTWDVSLLFAFISLLIMFPTCWIVSSWLVWGIILFLYL
IIRVLKLWRTAKLQMTLKKYRVRLEDMAANSRAFTNLVRKSLRLIQETEVISRGFTLVSA
ACSFNKAAQHPGQHLIGLRKAVYRTVRANFQAARLATLYMLKNYPLNSESDNVTNYICVV
PFKELGLGLSEDQISEEEARNLTDGFSLPALKVLFQLWVAQSSEFFRRLALLLSTANSPS
GPLLTAALLPHHILCDVTQGLPHAHSACLDELKRSYEFFRYFETQHQSVPQRLSKTPQKS
RELSNVHTAVRSLQLHLKALLNEVIILEDELEKLVCTKETQELLSEAYPILEQKLKLIEP
HVQASNSCWEEAISQVDKLLRRNTDKKGKPGVACENPHCTAEPLVRPALHIEDRDPIPEE
QELEAYVDDIDIESEFRKDDFYHLSQEDRERQKREQEESRRVLQELKSVLGFKASEAERQ
KWKQLLFSDHAVLTSLSPVDPVESVSNSEPPMNSDTEKVNSNATEEETSKPCAGDKEDSR
TEYVCDSPTEGPSKDTSADTGLLLPGAEETMCHQHESEAKSPQAAAAGATAPPTPRDTLQ
LSIKQRLARLQLPPEFTFSAGLAAEVAARSLSFTTMQEQTFGDEEEEQLVEGGENEVEEK
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgacaccggagtttgacgaagaggtggtttttgagaattctccactttaccagtaccta
caggatttgggacacacagattttgagatatgttcttcttcgtcaccaaaaccagaaaaa
tgcttgacaacagagggacctcagccgcctcccaccagagtcctacagagacaaggcatc
ctgttgaaactgacagaaaccatcaagagctggacgttttcctctcagcacagtaagaaa
gatgacttactccataagttggacaccgggtttcggctggactcactgcataccatcctg
cagcaggaagtcctgctgcaagaggatgtggagctgctcgagctgcttgacgccagcatc
ctgtctgcggggcagcctcaacaggaaagtggacaccttccaacgctctgctccctggca
accccgaacacttgggatgtctcgctgctgtttgccttcattagtttgctcatcatgttt
cccacgtgctggattgtgtcctcctggctggtgtggggaataattctatttctttacttg
atcatacgagttttgaaattatggaggacagccaaactgcaaatgactctgaaaaaatat
agggtacgtttggaagacatggcagccaatagccgagccttcaccaaccttgtgagaaaa
tcactgcgtctcatccaagaaactgaagtcatttccaggggatttactctggtcagtgct
gcttgctcatttaataaggctgcacagcatcccggccagcatctcatcggccttcggaaa
gccgtctacaggaccgtaagagccaactttcaagccgcaaggctagctaccttgtacatg
ctgaaaaactaccccctgaactctgagagtgacaatgtcaccaactacatctgtgtggta
ccttttaaggagctggggcttggactcagtgaagaccagatctcagaagaggaagctcgt
aacctgacagatggcttcagcctgcctgccttgaaggttttgttccagctctgggtggca
cagagttcagagttcttcagacgcctggccctgttactttctacagcgaattcgccttca
gggcccttactcactgctgcacttctgcctcatcatatcctctgtgacgtgactcaaggt
ctacctcatgctcactctgcctgcttggatgagctgaagcgcagctatgagttcttccgg
tactttgaaactcagcaccagtcagtcccccagcgcttatccaagactccgcagaagtcg
agggagctgagcaacgtccacacagcagtccgtagcttacagctccatctgaaagcacta
ctgaatgaagtaataattcttgaagatgaacttgaaaagctcgtttgtactaaagaaaca
caagagctgctatcggaggcttatccgatactagagcagaaattaaaactgattgaacca
cacgttcaggccagcaacagttgctgggaggaagccatttctcaagtggataaactgctc
cggaggaacacagataaaaaaggcaagcctggagtagcctgtgagaacccacactgcacc
gcggagcccttggtgcggccagctctacacattgaggacagagaccccatccctgaggag
caggaattagaagcttatgtggatgacatagacatagaaagtgagttccgaaaggacgat
ttctatcacttgtctcaggaagacagagagagacagaagcgcgagcaggaggagtccagg
cgggtgctgcaggagctgaagtctgtgctgggatttaaggcttccgaggctgagaggcag
aagtggaagcagctgctgttcagtgaccacgctgtgttgacatccttgtctcctgtagac
ccagtggaatctgtaagtaactcagaaccacccatgaattcagatacagaaaaagtcaat
agtaatgctactgaagaggagactagtaagccctgtgccggcgacaaggaagacagtagg
actgagtatgtgtgtgacagcccaacagaggggccaagcaaagacacctctgcagacaca
ggcctcctccttccaggagccgaggaaaccatgtgccaccagcatgagagtgaggctaag
tctcctcaggctgctgctgcgggggccactgcccctccgactcccagggacacactgcaa
ctctccattaagcagaggctggctcgactccagttgccaccagaattcaccttctctgct
ggcctggctgcagaagtggccgcccggtccctgtcctttaccaccatgcaggaacaaact
tttggcgacgaggaggaagaacagctagttgaaggcggtgaaaatgaggtggaggaaaaa
taa

DBGET integrated database retrieval system