KEGG   Mus musculus (house mouse): 215051
Entry
215051            CDS       T01002                                 
Symbol
Bud13, AV305342, D030060M11Rik
Name
(RefSeq) BUD13 homolog
  KO
K13106  pre-mRNA-splicing factor CWC26
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    215051 (Bud13)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   RES complex
    215051 (Bud13)
 Complex C
    215051 (Bud13)
SSDB
Motif
Pfam: Bud13 DUF2857
Other DBs
NCBI-GeneID: 215051
NCBI-ProteinID: NP_666112
MGI: 2443443
Ensembl: ENSMUSG00000032077
UniProt: Q8R149
Position
9:46194281..46210084
AA seq 637 aa
MAAAPPLTKAEYLKRYLSGTDAGLEGGPEAGRKRRKKRPKPGGAGGKGMRIVDDDVGWAA
ISTAKPEKEEEEDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHGEDGHFHHDDQD
SSPPRRVRHDTPDTSPPRKARHDTPDPSPPRKARHDTPDTSPPRKARHDTPDPSPPRKAR
HDTPDPSPPRRVRHDTPDLSPPRRVRHDTPDLSPPRRVRHDTPDPSPPRRVRHDLDASPP
RKSHRNSSAVSPRRGHHGSLGTSSPRQTHNHSPTAAQHRRTLDSSGTQHLRRAHHESPDL
ELHKAKSSKAAERAPSKAASQSGLGPSHPSLSTNSKYEHDSDLSPPRKRQAKAHFEAKKQ
LDSKGVYQKASDSDLSPPRKKKNSGHQDSDSDLSPPRNRPRRQSSDSDLSPPRRRQRTKS
SDSDLSPPRRSPRPGKKTAHMYSGAKTGLVTDVQREHQELKKQDQDTTDLGAQFEFTETV
FRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPL
ARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVKPRYSGPAPPPNRFNIWPGY
RWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggcggcagctccgccactcaccaaagctgagtatctgaagcgttacttgtctgggaca
gatgctggcttggaaggaggtcccgaggccggtcgcaagcggcgcaaaaaacggccgaag
cctggaggcgctggcggcaagggaatgcggattgttgatgatgatgtgggctgggcggct
atctctactgctaagccggaaaaggaggaggaagaggatggagatttgcctgtggtggct
gagtttgtggatgagcgtccagaagaggtaaagcagatggaggccttccgctccagtgcc
aagtggaagcttctgggaggccacggtgaagatggacattttcatcacgatgaccaagat
tcatctcctcctaggagggtccgtcatgacaccccagacacatctcctcccagaaaggcc
cgtcatgacaccccagacccatctcctcccaggaaggcccgtcatgacaccccagacaca
tctcctcccagaaaggcccgtcatgacaccccagacccatctcctcccaggaaggcccgt
catgacaccccagacccatctcctcccaggagagttcgtcatgacaccccggatctatct
cccccaaggagagttcgtcatgacaccccggatctatctcctcccaggagagtccgccat
gacaccccggatccatctcctcccaggagagtccgccatgacttagatgcttctcccccc
aggaagtctcatcgtaattcttcagccgtatctcctaggagaggccatcatggttcctta
ggtacctcttctccgagacagacccataaccactcccctactgcagcccagcatagaagg
actcttgactcttcaggtacacagcatctcaggagggcccatcatgagtcccctgatttg
gaactgcacaaagccaaaagtagtaaagctgcagaaagagcccctagcaaggctgcatcc
cagagtgggctaggaccctctcacccatcactctccaccaacagcaagtacgagcacgac
tctgacctctctcctccacggaaacggcaagcaaaggctcattttgaagctaagaaacag
cttgattctaaaggtgtctaccaaaaagcctctgattcagatctttctcctccacggaaa
aaaaaaaattcggggcaccaggattctgattcagatctgtcaccaccacggaacagacca
aggcggcagagctctgactccgacctctctccaccccggagaagacagaggaccaaatcc
tctgattctgacctctctccacctcgaaggagtccccgtcctggcaagaagactgcacac
atgtattccggagcaaaaactgggttggtcactgatgttcagcgggagcaccaggaactc
aagaaacaagaccaggacaccacagacctcggagcacagtttgaattcactgaaactgta
tttcgagacaagtctggtcggaagaggaatttgaagctagagcgcttggaacagaggaga
aaagcagagaaagactcagagcgagatgagctatatgcccagtgggggaaagggcttgcc
cagagccggcagcagcaacagaatgtagaagatgcaatgaaggagatgcagaagcctctg
gcccgctacatagatgatgaagatctggatcggatgctgagagaacaagaaagagaaggg
gacccgatggccaactttattaagaagaataaagctaaggagaacaagaataagaaagtg
aagccccgctacagtggtcctgctcctcctcccaatagattcaacatttggcctgggtat
cgctgggatggagtggacagatccaatggctttgaacagaagcgctttgccaggctcgcc
agcaagaaggctgtggaggagcttgcctacaagtggagtgtggaggatatgtga

DBGET integrated database retrieval system