KEGG   Mus musculus (house mouse): 215095
Entry
215095            CDS       T01002                                 
Symbol
Astl, 7420700F21, C87576, Sas1b
Name
(RefSeq) astacin-like metalloendopeptidase (M12 family)
  KO
K08778  astacin-like metalloendopeptidase [EC:3.4.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    215095 (Astl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     215095 (Astl)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   215095 (Astl)
SSDB
Motif
Pfam: Astacin Peptidase_M11
Other DBs
NCBI-GeneID: 215095
NCBI-ProteinID: NP_001277932
MGI: 3046414
Ensembl: ENSMUSG00000050468
Vega: OTTMUSG00000016024
UniProt: Q6HA09
Position
2:127180559..127199575
AA seq 435 aa
MGIMGSLWPWILTMLSLLGLSMGAPSASRCSGVCSTSVPEGFTPEGSPVFQDKDIPAINQ
GLISEETPESSFLVEGDIIRPSPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYDELSRRVI
MDAFAEFERFTCIRFVAYHGQRDFVSILPMAGCFSGVGRSGGMQVVSLAPTCLRKGRGIV
LHELMHVLGFWHEHSRADRDRYIQVNWNEILPGFEINFIKSRSTNMLVPYDYSSVMHYGR
FAFSWRGQPTIIPLWTSSVHIGQRWNLSTSDITRVCRLYNCSRSVPDSHGRGFEAQSDGS
SLTPASISRLQRLLEALSEESGSSAPSGSRTGGQSIAGLGNSQQGWEHPPQSTFSVGALA
RPPQMLADASKSGPGAGADSLSLEQFQLAQAPTVPLALFPEARDKPAPIQDAFERLAPLP
GGCAPGSHIREVPRD
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgggtatcatgggaagcctgtggccttggatattaactatgctctccttgctaggtttg
agcatgggagcaccctcagcatccagatgttctggagtctgcagtaccagtgttccagaa
ggcttcactcctgagggaagcccggtatttcaggacaaggacatccccgcaattaaccaa
gggctcatctcagaggagaccccagaaagcagcttcctggtagaaggggacattatccgg
ccaagccctttccgattgttgtcagtgaccaataataaatggcccaagggcgttggtggc
tttgtggagatccccttcctgctttccagaaagtatgatgaactcagccgccgggtcatt
atggatgcctttgctgagtttgaacgtttcacatgcatccggtttgttgcctaccatggt
cagagagactttgtttccattcttcctatggcggggtgtttctctggtgtgggacgcagt
ggagggatgcaggtggtgtccttggcacccacttgtctccggaagggccgaggcattgtc
ctacatgagctcatgcacgtacttggcttctggcatgagcattcacgggcagatcgggac
cgctacatccaagtcaactggaacgagatcctcccgggctttgaaatcaacttcatcaag
tcacggagtaccaatatgttagttccctatgactactcatctgtgatgcattatgggaga
tttgccttcagctggcgtgggcagcccaccatcataccactctggacctccagtgttcac
attggccagcgatggaacctgagtacctcagatatcacccgggtctgcaggctgtataac
tgcagccggagtgtccctgactcccacgggagagggtttgaggcccagagtgatggaagc
agcctcacccctgcctctatatcacgtctacaaagacttctcgaggcactgtcagaggaa
tctggaagctctgcccctagtggctccaggactggaggccagagtattgccgggcttggt
aacagccagcaaggatgggagcatcctcctcagagcacattcagtgtgggagccttggca
agaccacctcagatgctagccgatgcttcaaaatcggggcctggagcaggtgcagacagc
ttgtctctagagcagttccagctagcccaggcccccactgtacctcttgctctatttcca
gaagccagagacaagccagcacctatccaagatgcctttgagaggctagctccacttcca
ggaggctgtgcacctggaagtcacattagagaggtgcccagagactga

DBGET integrated database retrieval system