KEGG   Mus musculus (house mouse): 215201
Entry
215201            CDS       T01002                                 
Symbol
Trmt2b, 4732479N06Rik
Name
(RefSeq) TRM2 tRNA methyltransferase 2B
  KO
K15331  tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    215201 (Trmt2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.35  tRNA (uracil54-C5)-methyltransferase
     215201 (Trmt2b)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    215201 (Trmt2b)
SSDB
Motif
Pfam: Methyltransf_31 Methyltransf_25 tRNA_U5-meth_tr MTS Methyltransf_4 Methyltransf_12 Methyltransf_32 Methyltransf_11 PrmA Ubie_methyltran Methyltransf_15 N6_N4_Mtase
Other DBs
NCBI-GeneID: 215201
NCBI-ProteinID: NP_001161466
MGI: 2442530
Ensembl: ENSMUSG00000067369
UniProt: Q8BQJ6 Q8C8J3
Position
X:complement(133123704..133177770)
AA seq 493 aa
MHNPRLFLSRAGFFSKPGLLPWDTGRPPDLSQSLLGRAYKGSFTSVIAKKHPSRQKYQKK
QRHCRDDSWQERLADVVTPLWRLSYEAQLKVKFEAQKKLLQSLESHLKVLHGVSDTVAAH
QSEGLRCLLHPIIPSPTTTGYRNKSTFSVYRSPDGNPKTVGYYLGTWKDGNVVCLPCNHL
KNIPEKHSQVAQYYEVFLRQSSVEPCLLFHEGGHWRELVVRTNRQGHTMAIVTFHPQGLS
EEEVCVQKVTLKDFFTKGPGAICELTSLYFQESTMTRCSHQQSPYQLLFGEPHIFEDLLG
LKIRISPDAFFQINTAGAEMLYRIIGELSGVNSESLLLDICCGTGVIGLSVAQRASQVHG
IELVEQAVEDARWTAAFNGVTNCEFHAGRAETILPQLLKSQKDEKLTVAVVNPARAGLHY
RVVRAIRNCRTIHTLVFVSCKPHGESTRNFIELCCPPNSAKQLLGDPFVLREAVPVDLFP
HTPHCELVLLFTR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcacaacccaagactattcctttccagagcgggtttcttctccaaaccaggactgctt
ccctgggatactggaagaccaccagatttgtcacagtccttattgggcagagcatataaa
gggagtttcaccagcgtgatagctaagaagcacccaagcagacaaaaatatcagaagaaa
caaaggcattgtagagatgactcctggcaggagaggctggctgatgttgtgactccactc
tggaggctgagttatgaagcacaactcaaggtgaaatttgaagctcagaagaaactttta
caaagcctagagtctcacctaaaagtgctccatggagtcagtgacacagtggctgcacat
cagtctgaggggctccgctgtctcctccatcccattataccctctcctaccaccactggc
taccggaacaagtccaccttttctgtgtacaggagcccagatggcaatccaaagactgtg
ggctactacctaggaacttggaaagatggaaatgtcgtctgtctaccatgtaatcatctg
aaaaacatcccagagaaacacagtcaagtggctcagtactatgaagtattccttcgacag
tcttcagtggaaccctgccttctctttcatgaaggtggacactggcgtgaactcgtagtt
cgtaccaataggcaaggacacacaatggctattgtcacttttcatccccagggattaagt
gaggaggaggtctgtgttcagaaggtgaccttgaaggattttttcactaaaggccctgga
gcgatctgtgaattgacctcgctctatttccaggaaagcaccatgacccgttgcagccat
cagcagtccccctaccagctcctgtttggggagccccacatctttgaggatcttctgggt
ttgaagattcgaatttctccagatgccttcttccagattaatactgctggggcagagatg
ctgtatcggatcattggggagctgagtggagtgaactctgagagcctcctcctagacatt
tgctgtggcacgggtgtgattggcctctctgtggctcagcgtgcctcccaggttcatggc
attgagctagtggagcaggcagtagaggatgccaggtggactgcagccttcaatggtgtc
accaactgtgagtttcacgctggcagagcagagacgattttgccacagctgttaaagtca
cagaaagatgagaagttgactgttgctgtggtgaaccctgcccgagctggattgcattac
agagtggtgcgagccattcggaactgcaggaccatccacactctagtgtttgtttcctgc
aagccccatggtgaaagcacaaggaacttcattgaactatgctgtcctccaaattctgca
aagcagctcctaggtgatccattcgtcctgagagaagctgtacctgtggatttgtttccc
cacaccccacactgtgagctggttctcctcttcactcggtaa

DBGET integrated database retrieval system