KEGG   Mus musculus (mouse): 215210Help
Entry
215210            CDS       T01002                                 

Gene name
Tmem120a, 2010310D06Rik, Tmpit
Definition
(RefSeq) transmembrane protein 120A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TMPIT HAUS-augmin3 Hox9_act
Motif
Other DBs
NCBI-GeneID: 215210
NCBI-ProteinID: NP_766129
MGI: 2686991
Ensembl: ENSMUSG00000039886
Vega: OTTMUSG00000029604
UniProt: Q8C1E7
Position
5; 5 G2
AA seq 343 aa AA seqDB search
MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRLKLEELTKLQANCTNSITRQKKRLQE
LALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP
ECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQQHGNKKD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccccgcccccggacccgctgggcgactgcctgcgcaactgggaggatctgcag
caggacttccaaggtatccaggaaacacatcgcctgtatcgcctcaagctagaggagctg
accaaactccaggccaactgtacaaactccatcacacggcagaagaagcggctccaggag
ctggccttggtgctgaaaaaatgcagaccctctctcccatccgagtccatggaggctgca
caggagctggaaaaccagatgaaagagcgccaaggcctcttcttcgacatggaagcctat
ctgcctaagaagaacgggttgtacctgagtctggttctggggaatgtcaacgtgacactt
ctgagcaagcaggctaagttcgcttacaaagacgagtacgagaaattcaagctctacctc
accatcatcctcatcgtcatctccttcacctgccgcttcctgctcaactccagggtgacg
gacgcagccttcaacttcctgctggtctggtattattgcacgctgaccatccgggagagc
atcctcatcaacaatggttccaggatcaaaggctggtgggttttccatcattatgtgtcc
acattcctgtcaggagtcatgctgacctggccagatggactcatgtaccagaagttccgg
aaccagttcctgtctttctccatgtaccagagctttgtgcaattcctgcagtattactat
cagagcgggtgcctgtaccgcctgcgagccctgggcgagcgccatacgatggatctcacc
gtagagggctttcagtcttggatgtggagaggcctcaccttcctgcttccgttcctcttc
tttggacacttctggcaactcttcaatgcgctgacattgtttaacttggcccgggacccg
gagtgcaaggagtggcaggtgctcatgtgcggcttccccttcctcctcctcttcctcggc
aatttcttcaccaccctgcgagtggtgcatcagaagttccacagccagcagcacgggaac
aagaaggactga

DBGET integrated database retrieval system