KEGG   Mus musculus (house mouse): 215210
Entry
215210            CDS       T01002                                 
Symbol
Tmem120a, 2010310D06Rik, Tmpit
Name
(RefSeq) transmembrane protein 120A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TMPIT EzrA
Other DBs
NCBI-GeneID: 215210
NCBI-ProteinID: NP_766129
MGI: 2686991
Ensembl: ENSMUSG00000039886
UniProt: Q8C1E7
Structure
Position
5:complement(135764344..135773026)
AA seq 343 aa
MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRLKLEELTKLQANCTNSITRQKKRLQE
LALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP
ECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQQHGNKKD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgcagtccccgcccccggacccgctgggcgactgcctgcgcaactgggaggatctgcag
caggacttccaaggtatccaggaaacacatcgcctgtatcgcctcaagctagaggagctg
accaaactccaggccaactgtacaaactccatcacacggcagaagaagcggctccaggag
ctggccttggtgctgaaaaaatgcagaccctctctcccatccgagtccatggaggctgca
caggagctggaaaaccagatgaaagagcgccaaggcctcttcttcgacatggaagcctat
ctgcctaagaagaacgggttgtacctgagtctggttctggggaatgtcaacgtgacactt
ctgagcaagcaggctaagttcgcttacaaagacgagtacgagaaattcaagctctacctc
accatcatcctcatcgtcatctccttcacctgccgcttcctgctcaactccagggtgacg
gacgcagccttcaacttcctgctggtctggtattattgcacgctgaccatccgggagagc
atcctcatcaacaatggttccaggatcaaaggctggtgggttttccatcattatgtgtcc
acattcctgtcaggagtcatgctgacctggccagatggactcatgtaccagaagttccgg
aaccagttcctgtctttctccatgtaccagagctttgtgcaattcctgcagtattactat
cagagcgggtgcctgtaccgcctgcgagccctgggcgagcgccatacgatggatctcacc
gtagagggctttcagtcttggatgtggagaggcctcaccttcctgcttccgttcctcttc
tttggacacttctggcaactcttcaatgcgctgacattgtttaacttggcccgggacccg
gagtgcaaggagtggcaggtgctcatgtgcggcttccccttcctcctcctcttcctcggc
aatttcttcaccaccctgcgagtggtgcatcagaagttccacagccagcagcacgggaac
aagaaggactga

DBGET integrated database retrieval system