KEGG   Mus musculus (mouse): 215335
Entry
215335            CDS       T01002                                 

Gene name
Slc36a1, 5830411H19Rik, AI839897, Pat1
Definition
(RefSeq) solute carrier family 36 (proton/amino acid symporter), member 1
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    215335 (Slc36a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    215335 (Slc36a1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    215335 (Slc36a1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    215335 (Slc36a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   215335 (Slc36a1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 215335
NCBI-ProteinID: NP_694779
MGI: 2445299
Ensembl: ENSMUSG00000020261
Vega: OTTMUSG00000005687
UniProt: Q8K4D3 Q5F227
Position
11; 11 B1.3
AA seq 475 aa
MSTQRLRNEDYHDYSSTDVSPEESPSEGLGSFSPGSYQRLGENSSMTWFQTLIHLLKGNI
GTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVM
YGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCN
NNVTVIPTPTMDSRLYMLSFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQ
RIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPLILYLGMAIITV
LYISLGSLGYLQFGANIKGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVAAEIIIPA
IVSRVPEHFELMVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEV
VTYYGEGISPLTVTKDALISILGFVGFVVGTYESLCELIQPSHSDSSTNSTSAFI
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtccacacagaggcttcggaacgaagactatcatgactacagttccacagacgtgagc
cccgaggagagcccatctgaaggccttggcagcttctcccccggctcctaccaacgctta
ggagagaacagtagcatgacatggttccagaccctgatccacctgctgaaaggcaacatt
ggcaccggactgctggggctgcctctggcagtgaagaacgcaggcctcctgttgggtcct
ctcagcctgctggtgattggtatcgtggccgtgcactgcatgggtatcctggtgaagtgt
gctcatcacttatgtcgtagactgaacaaaccctttttggactatggggacacggtgatg
tatggactagaatgcagccccagcacctgggtccggaaccactcccactggggaaggcgc
atcgtggacttcttcctcatcgtcactcagctgggattctgctgtgtctacttcgtgttt
ctggcggacaactttaagcaggtgatagaggcagccaatgggaccaccaccaactgcaac
aacaatgtgaccgtgatcccgacgcccaccatggactctcgactctacatgctctccttc
ctgcccttcctggtgttgctgtctttcatcaggaacctgcgtgtgttgtccatcttctcc
ctgctggccaacatcagcatgttcgtcagcctgatcatgatataccagttcattgtccag
aggatcccagaccccagccacctccccttggtggctccatggaagacctaccctctgttc
tttggcacagcgatttttgcttttgaaggcattggagtggttctaccccttgagaacaaa
atgaaggactcacagaaatttccattgattctgtatttggggatggctatcatcactgta
ctctacatcagcctggggagcctggggtacctgcaatttggagctaatatcaagggcagc
atcaccctcaacctgcccaactgctggttgtaccagtcggtgaagctgctgtactccata
ggcatcttcttcacctatgccctccagttctatgtcgcagctgagatcatcatcccggcc
attgtgtcccgagtgcctgagcatttcgagctgatggtggacctttgtgtgcgcaccgcc
atggtctgtgtgacatgtgtgctggccatcctcatcccacgcctggacctggtcatctcc
ctggtgggctctgtgagcagcagcgccctggccctcatcatcccgcccctgctggaggtg
gtcacctactatggagagggcattagccccctgaccgtcaccaaggatgccctcatcagc
atcctgggcttcgtgggcttcgtggtggggacctacgagtctctgtgtgagctgatccag
ccaagccatagcgactcctctaccaattccaccagtgccttcatataa

DBGET integrated database retrieval system