KEGG   Mus musculus (mouse): 215351
Entry
215351            CDS       T01002                                 

Symbol
Senp6, 2810017C20Rik, E130319N12Rik, Susp1, mKIAA0797
Name
(RefSeq) SUMO/sentrin specific peptidase 6
  KO
K08595  sentrin-specific protease 6 [EC:3.4.22.68]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    215351 (Senp6)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    215351 (Senp6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     215351 (Senp6)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   215351 (Senp6)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   215351 (Senp6)
SSDB
Motif
Pfam: Peptidase_C48 zinc_ribbon_2 tRNA-synt_1g OrfB_Zn_ribbon zf-ribbon_3 DZR_2 C1_1
Other DBs
NCBI-GeneID: 215351
NCBI-ProteinID: NP_666115
MGI: 1922075
Ensembl: ENSMUSG00000034252
Vega: OTTMUSG00000042004
UniProt: Q6P7W0
Position
9; 9 E1
AA seq 1132 aa
MAAGKSGGSAGALFLKALDRSESKRDGGFKNNWSFDHEEESEGDADKDGANLLSVEDEDS
EISKGKKLNRRSEIVATSSGDFILKTYVRRSKTDGFKTLKGNPIGLNMLSNNKKLSESTA
GTALCSGTVVHGRRFHHAHSQTPGIRTAAQRKEYPPYVHKAENSPVMLSHGQGGDHIMKK
TEESESYVESEIKRKVQQKRHCSTYQLSPLSPASKKCLTHLEVSEQREYCPKCGKEKENQ
TKCQSCGIVFHNDLQRNCRQAVTLNEPTGPLLRTSIHQNSGGQKSQNTGLTAKKFYGNSV
DKIPIDILVTCDDSRHNYIQTNGKVILPGGKIPKLTNPKERKISVSDLNDPIILSSDDDD
DDDDRTKRRESTSPKPADSACSSPVPSTGKVEAALNADACRAEQEPRSSPAEPELNTIVI
PRKARMKDQLGNSISTPLKRRKVNSHAAFIHPMSLSCQNFESVILNCRSIRVGTLFRLLV
EPVIFSLESITIHLDGPESDPVDIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSMQ
LQMSKEDKVWNDCKGINRITSLEEQYIILIFQTGLDHQAEVVFESIITDIGIRNNVPNFF
AKILFDEANSRLVACTRSYEESIKGNCAQKENKVKTVSFESKIQLRSKQELQFFDDDEEA
GESHTIFIGPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLK
KEDADRIHIFSSFFYKRLNQRERRNPETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPL
NEAAHWFLAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNSAAK
PVIKKMLNRKHCLAVTDSSAAQEESEPCYRRNAYSVKCSMKKKNHAINENEEPSNGESTC
QDICDRTQSENGLRDECFSSVHHPDALSKIRLNYGDQSADGGKLLEDELIDFSEDQDDPD
DSSDDGLLADENYSSEIGQWHLKPTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEV
KKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFELPMNLMNWFPP
PRMKTKREEIRNIILKLQESQSKDKKLLKDSLAETSLGDGAEQYASASGGSE
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggcggcgggcaagagcggtggcagcgctggggctcttttcctgaaagctttggataga
tcagaatctaagagggatggaggctttaaaaataattggagctttgatcatgaagaagaa
agtgaaggagatgcagacaaagatggggcaaatctactcagtgtagaagatgaggattct
gaaatctcaaaaggaaaaaagttaaatcggagatctgaaattgttgctactagttctggt
gatttcatcttgaagacttatgtaaggcggagcaagactgacggctttaaaactttgaaa
ggcaacccaattggacttaacatgttaagcaacaataagaaactgagtgaaagcaccgca
ggcacagcattatgttctggaactgtggttcatgggaggcgcttccatcatgctcactca
cagacgccaggcatcagaacagcggctcagaggaaagaatacccaccttatgtccacaaa
gctgaaaacagccctgtaatgctaagtcatggccaaggtggagaccatataatgaagaaa
actgaagagtcagaatcatatgtagagtctgagattaagaggaaagtccagcagaagcgg
cactgtagcacttaccagctttctcctctgtcccctgcctcaaagaagtgtttgacccat
ttagaggtttctgaacagcgtgaatattgcccaaaatgtggaaaagaaaaagaaaatcag
accaaatgccaaagttgtggtattgtttttcataatgatttgcaaagaaattgccgacaa
gccgtaactttgaatgaacctactggaccattgctaagaacatcaattcatcagaactct
ggaggacagaaatcacaaaacacaggactaacagctaagaaattttatgggaacagtgtg
gataagattccaattgatattttggtcacctgtgatgatagcagacataattacatacag
acaaatgggaaagtcattttacctggaggaaaaatacctaaactcacaaacccaaaagag
cgaaagataagcgtgtcagatttaaacgatccaatcattttgtctagtgatgatgatgac
gacgacgacgataggactaagagaagagagagcacgtccccgaagcctgccgactcagca
tgctcctcaccagtaccatctacgggaaaagttgaagctgcactaaatgcagatgcctgt
agagcagagcaggaacccagaagcagtccagcagagcctgagttaaataccattgtcata
ccacgaaaagcaagaatgaaggaccagcttggtaattccatcagcacacctttaaaacgt
cgtaaagtaaacagtcatgcagcttttattcaccctatgtctttaagttgccaaaacttt
gaaagtgtcattttaaactgccgaagtatacgagttggaacactcttccgactgttggta
gagcctgtaattttttctttagagtcaatcacgatacatctagatggaccagaaagtgat
cctgtagacattattttaaatacctctgatctaactaaatgtgaatggtgtaatgtccgg
aaattaccagtagtgtttctccaggcaataccagcagtttaccagaagctgagcatgcag
ctacagatgagtaaagaagataaagtttggaatgattgtaaaggaataaacaggataaca
agtttagaagaacagtacattattttaatttttcaaactggccttgatcatcaggcagag
gtggtctttgaaagtatcattactgacattggtataaggaataatgttcccaactttttt
gcaaaaattctttttgacgaagccaatagcagacttgttgcctgtacaagaagctatgaa
gagagcatcaaaggaaactgcgcgcaaaaagagaacaaagtgaaaactgtgtcgtttgaa
tctaaaatacaacttagaagcaaacaagaattgcagttttttgatgatgacgaagaagct
ggggagagccatacaatcttcattggccctgtagaaaaattgatagtatacccaccacct
ccagctaagggaggcatttctgttactaatgaggacctgcactgtctaagtgaaggagag
tttttaaatgatgttattatcgacttttatttgaaatacttggtgcttgaaaaactgaag
aaagaagacgctgaccgaattcatatatttagttcttttttctataaacgccttaatcag
agagagaggagaaatcctgagacaactaatctgtcgatacaacaaaaacggcatgggaga
gtaaaaacgtggacacggcatgtagatatttttgagaaggactttatttttgtacccctt
aatgaagctgcacattggtttttggctgttgtttgtttccctggtttggaaaaaccaaaa
tatgaacctaatcctcattaccatgaaaatgcagtcatgcaaaaaactccaagtgcagag
gacagttgtgtttcttctgccagtgagatgggtgcttgttcacagaactctgctgccaag
cctgtgatcaagaagatgttaaatagaaaacattgcttagctgtgactgattcgagtgct
gcacaggaagaaagtgagccttgttaccggagaaacgcatacagtgtaaagtgtagtatg
aaaaaaaaaaatcatgctatcaatgaaaatgaagaaccaagtaacggagaatctacgtgc
caggacatttgtgatagaacccaaagtgagaatggcctccgggatgaatgcttcagttct
gtacatcatccagatgccttaagcaaaatcagactaaactacggtgatcagtcagcagac
ggtgggaagctgcttgaagatgagctcattgacttctcagaggatcaggatgacccggat
gatagcagtgatgacggactccttgctgatgaaaactacagttcagaaataggacagtgg
catttaaagcctactgtctgtaaacaaccttgtatcctccttatggactcactcagaggc
ccttctcgttcaaatgttgtcaaaattctaagagagtatttagaagtggaatgggaggtg
aaaaaaggaagcaaaagaagtttttccaaagatgttatgaaagggtccaacccaaaagtc
ccacaacagaacaacttcagtgactgtggtgtctatgtgctgcagtatgtagagagcttt
tttgagaatccagtactaaattttgagctccctatgaatttgatgaactggtttcctccc
cccagaatgaaaacaaaaagagaagaaatccgaaacataattttgaagctacaggaatca
cagagtaaagacaagaagctgctgaaggactccttagcagagacgtccttaggggacgga
gcagagcagtacgccagcgccagcggtggctcagagtga

DBGET integrated database retrieval system