KEGG   Mus musculus (mouse): 215387
Entry
215387            CDS       T01002                                 

Symbol
Ncaph, A730011O11Rik, Brrn1, CAP-H, HCAP-H, mCAP-H
Name
(RefSeq) non-SMC condensin I complex, subunit H
  KO
K06676  condensin complex subunit 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    215387 (Ncaph)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    215387 (Ncaph)
SSDB
Motif
Pfam: Cnd2 CNDH2_N
Other DBs
NCBI-GeneID: 215387
NCBI-ProteinID: NP_659067
MGI: 2444777
Ensembl: ENSMUSG00000034906
Vega: OTTMUSG00000016017
UniProt: Q8C156
Position
2:complement(126945729..126975874)
AA seq 731 aa
MRIPRSETMNSSFLKARGQQDVLSSPLERVPPASRPGKAPLGTPKTPVLEDFPQNDDEKE
RMQRRRSRVFDLQFSTDSIHLASPNRNIDVSTTISKFTNTQITEHYSTCIKLSSENKITT
KNAFGLHLIDFMSEILKQKDAEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGK
DTPPQGEESHSGDGSTLETERTKKPAKPKKKQSCKTIEQNLSNINVSEADGKCAVDPMFQ
KTAASFDECSTTGVFLSTLHCQDYRSELLFPSDMQTLSSGEPLELPDLGFVDMTDLEASL
QQCVEDRPLCPSLAGFQFTKWDSETHNESVSALVDKFKKNDQVFDINAEAEDDEEDVPDG
PLVEDFVDNDEPDLSAAGDHEEFRSWKELCQVQSNQEEVISLEDRDIQVMCSFLSMKPGE
YSYFSPRTMKMWAGPDHWRFRPRPKQDATSCTEHKKKSAKKDFEINFDDDIDFDAYFQKT
KAATILTKSTLENQNWKATTLPTDFHYETDNLIQLHLKPGKRSLKMDQDQKAKTEHYEEI
EDYDYNNPNDTSNYCPGLQAADSDYEEADDLFADPVGTLDLESDPKTTQENGHISPENQG
VDITTYQELNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTKFSRKEADTEANHT
ESGQEGAPEEVADEKKLSGLTKDLQTRLPPLMAQNLSIPLAFACLLHLANEKNLKLEGTE
DLSDVLVMQGD
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgagaattccgcgctcagaaacaatgaatagctcttttctgaaggcccgaggacaacag
gatgttctttcctcacctttggaacgggtgcccccagcatcccggcccgggaaggctcca
cttggcactcctaaaaccccagtcctcgaagactttcctcagaatgacgatgaaaaggag
cggatgcagcggagacgctccagggtctttgacctgcagttcagtacagattcgattcat
ctggcctcccctaacaggaatattgatgtttcaactaccatatctaagtttacaaacaca
cagattacagaacattactctacctgtatcaagctttcttctgaaaataaaatcactact
aagaatgctttcggcttgcatttgattgatttcatgtcagagattctgaagcagaaagat
gcagaaccaaccaactttaaagtggctgctggcaccttggatgccagcaccaagatctat
gctgtccgtgtggatgccgtccatgctgatgtatacagagtccttggggggctgggcaaa
gacacaccacctcaaggagaggagagccacagtggagatggaagtacccttgaaacagaa
aggactaaaaaacctgcaaagccaaagaagaagcagtcctgcaaaaccattgaacagaat
ctcagcaatatcaatgtctcggaagccgatgggaagtgtgcggtggatcctatgtttcag
aagacagcagcctcctttgatgaatgcagcacgactggggtatttctctccacgctgcac
tgccaggactacagaagcgagctgctctttccttccgacatgcagaccctctcctcagga
gagcccctcgagctgccggatctgggtttcgtagacatgacagatttagaagcttccttg
cagcagtgtgtggaagaccgcccgctctgcccatccctggccgggttccagtttactaaa
tgggacagcgaaacacataatgagtctgtgtcggccctggtggacaagtttaagaagaat
gatcaagtatttgacatcaatgctgaggctgaagacgatgaagaggatgtccctgatggg
cccctggtggaggattttgttgacaatgatgagccagacctttctgcagctggggaccat
gaagagttccggagctggaaggagctctgtcaggtccagagcaaccaggaagaagttatt
tccctcgaggacagagacatccaagtcatgtgctcctttttatccatgaaacctggggaa
tattcctatttcagtccccggaccatgaagatgtgggctggcccagatcactggcgcttc
aggcctcgacccaagcaagatgctacctcctgcacagagcacaaaaagaagagtgcaaag
aaagactttgaaattaattttgatgatgatattgattttgatgcatattttcagaaaaca
aaggctgctaccattctgaccaagtccactttggagaaccagaattggaaagccaccact
cttcccacagatttccactatgaaactgataatctgatccagcttcacctcaaaccaggc
aaaaggtcacttaagatggaccaggaccagaaggctaagactgagcactatgaggaaatt
gaagactatgattacaacaaccctaacgacacctccaactattgtcctggacttcaggct
gctgacagtgattatgaagaggcagacgatttatttgcggatccagtcgggacccttgac
cttgagtctgatccaaagacaacacaagagaatggtcacatttctcctgaaaaccaagga
gtagatatcacaacttaccaagagttgaacttggtggctgagcctcaaaaggtgaataaa
atagaaattcattacgccaagactgccaaaaagatggacatgaagaagctgaagcagagt
atgtggagtctgctgacgaagttttctaggaaggaggctgacacagaggcaaaccacact
gaaagtggacaggaaggtgcccccgaggaagtggctgatgagaagaaactcagtgggctc
acaaaggacctgcagacaaggctgcccccgctcatggctcagaacctctccatacccctg
gcttttgcctgtcttctgcacttagcaaatgaaaagaatctgaagctagaaggcacagag
gatctttctgatgttctggtgatgcaaggggactga

DBGET integrated database retrieval system