KEGG   Mus musculus (mouse): 215418
Entry
215418            CDS       T01002                                 

Gene name
Csrnp1, 4931429D10Rik, Axud1, CSRNP-1, URAX1, taip-3
Definition
(RefSeq) cysteine-serine-rich nuclear protein 1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    215418 (Csrnp1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    215418 (Csrnp1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     215418 (Csrnp1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     215418 (Csrnp1)
SSDB
Motif
Pfam: CSRNP_N
Other DBs
NCBI-GeneID: 215418
NCBI-ProteinID: NP_695019
MGI: 2387989
Ensembl: ENSMUSG00000032515
Vega: OTTMUSG00000062306
UniProt: P59054
Position
9; 9 F4
AA seq 583 aa
MTGLLKRKFDQLEEDDSSSSSSSSFSSRLSLSSFPASSASPAWNSDEEGPGGQAPQSDQD
SCGLQSFTPPSILKRAPRERPGHVAFNGITVYYFPRCQGFTSVPSRGGCTLGMASRHSTC
RLFSLAEFTQEQVRARREKLRRRLKEEKLEMLRWKFSVAGVPESGAGVPLTADAIDDASV
EEDLAVAVANGRLEEANFLQPHPPRQRRALLRASGVRRIDREEKRELQVLRQSREDCGCH
CDGVCDPETCSCSLAGIKCQMDHTSFPCGCCREGCENPNGRVEFNQTRVQTHFIHTLTRL
QMEQGAESLGDLESPVEDTPVEQAALSPFPPSKPPVSSELGDSSCSSDMTDSSTTLSSGS
SEPPNHPAHPSLPGPSFRSGVDEDSLEQILNFSDSDLGIEEEEEEGGGVGNLDNLSCFHL
ADIFGTGDPGSLASWTHSQSGSSLASGILDENANLDASCFLNSGLGGLREGSLPGSSGSP
EGDAVQSSSWDLSLSSCDSFELLQALPDYSLGPHYTSRRVSGSPDSLETFHPLPSFSPPR
DASTCFLESLVGLSEPVTEVLAPLLESQFEDAALAPLLEPVPV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgactgggctactgaagaggaagtttgaccagctggaagaggacgactccagttcctcc
tcctcctcatcgttctctagccggctctctctctcctccttccccgcctcttctgcctcc
cctgcctggaactctgatgaggagggaccaggtggtcaggcaccccagtctgatcaggac
tcctgtggcctccagagtttcactcccccgtccatcctgaagcgggctcctcgggagcgt
ccaggtcacgtggcctttaacggcatcaccgtctactatttcccacggtgccagggattc
accagtgtgcccagccgtggtggctgtaccctgggcatggcttctcggcacagcacctgc
cgccttttctccttagctgagtttacacaggagcaggtccgggctcggcgtgagaagctc
cgccgccgtttaaaggaggagaagctggagatgctgaggtggaagttttcagtggctgga
gttccggagtcaggggcaggcgtgcctctcacagcggatgccatcgatgacgcctctgta
gaggaggacttggcagtggccgtggcaaatggccgcctggaggaagccaatttcctccag
ccccatccacctcggcagcgacgggctctccttcgggcttccggcgttcgaaggattgac
cgagaggagaagcgggagctgcaggtgctgcgccagtcccgggaggattgtggttgtcac
tgtgatggcgtctgtgaccctgagacctgcagttgcagcttggccggcattaagtgccag
atggatcacacgtccttcccctgtggctgctgcagggagggctgcgagaaccccaatggt
cgagtggaattcaatcagacaagagttcagacgcacttcattcacaccctcacccgcctg
cagatggagcagggtgccgagagcttgggggacctggagtcccccgtggaggacactcct
gttgaacaagccgcgctttccccctttccgccttccaagccccctgtgagcagtgaactg
ggggacagcagttgcagcagcgatatgacagactcttccacgaccttgtcctctggcagc
agcgagcctccaaaccaccctgcccaccccagcctgccaggtcccagcttccggtctggc
gtagatgaagacagcctggaacagatcctgaatttcagtgactctgacctcggaattgag
gaggaggaggaggagggagggggtgtgggcaacttggataacctcagctgcttccatctg
gctgacatctttggtaccggtgaccccggcagcctggccagctggactcacagccagtct
ggctctagcctcgcatcgggcatcctagatgagaatgccaacctggacgccagttgcttc
ctgaacagcggacttggagggctgagagaaggtagcctccctggcagttctgggtcccct
gagggggacgccgtccagagcagctcctgggacctcagcttatcctcctgtgactccttt
gagcttctccaggctctgccagattatagtctgggacctcactatacttcccgaagggtg
tcgggcagcccggatagccttgagaccttccacccattgcccagcttctctccaccacgg
gatgcgagcacttgcttcctggagtctctcgtgggcctgtctgagccggttacagaagtc
ctggcaccccttctggagagccagtttgaggatgctgccttggcacctttgttggagcct
gtgccagtgtaa

DBGET integrated database retrieval system