KEGG   Mus musculus (mouse): 215436
Entry
215436            CDS       T01002                                 

Symbol
Slc35e3, 9330166G04Rik, AI481200
Name
(RefSeq) solute carrier family 35, member E3
  KO
K15285  solute carrier family 35, member E3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    215436 (Slc35e3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   215436 (Slc35e3)
SSDB
Motif
Pfam: TPT EamA
Other DBs
NCBI-GeneID: 215436
NCBI-ProteinID: NP_084151
MGI: 2448489
Ensembl: ENSMUSG00000060181
UniProt: Q6PGC7
Position
10; 10 D2
AA seq 313 aa
MASLADRVRGNGRIAAGLLFNLLVSICIVFLNKWIYVHHGFPNMSLTLVHFVVTWLGLYI
CQKLNIFAPKSLPLSKLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQTF
WYQKRFSVRIQLTLIPITVGVILNSYYDVKFHSLGMVFAALGVVVTSLYQVWVGAKQHEL
QVNSMQLLYYQAPMSSAMLLVAVPFFEPVFAEGGIFGPWSVSALLMVLLSGIIAFMVNLS
IYWIIGNTSPVTYNMFGHFKFCITLCGGYILFKDPLSVNQGLGILCTLFGILTYTHFKLS
EQEGSKSKLVQRP
NT seq 942 nt   +upstreamnt  +downstreamnt
atggcatcgctggcggaccgggtccggggcaacgggcgcatcgccgccgggctcctgttc
aacctgctggtgtccatctgcatcgtgttcctcaacaaatggatctatgtacaccacggc
ttccccaacatgagcctgaccctggtgcacttcgtggtcacctggctgggcttgtacatc
tgccagaaactgaacatctttgcccccaaaagtctgccgctctccaagctcctcctcctg
gccctcagcttctgtggctttgtggtcttcaccaacctttctctgcagaacaacaccata
ggcacctatcagctggccaaggccatgaccacgccggtgatcatagccatccaaaccttc
tggtaccagaagagattctccgtcagaatacagctcacgctgattcctattactgtaggt
gtaatcctaaattcttattacgatgtgaagtttcattcgcttggaatggtgtttgccgcc
cttggtgtggtagtcacgtccctttatcaagtgtgggtcggagccaagcagcacgaactg
caggtgaactccatgcagctactttactaccaggcccccatgtcttctgccatgctgctg
gtggctgtgcccttcttcgagccagtgtttgcagagggaggaatatttggtccctggtca
gtttctgctttgcttatggtactgctgtctggaataatcgctttcatggtgaacttatcg
atttactggatcattgggaacacgtcaccagtcacctacaacatgttcggacacttcaag
ttctgcatcactctctgcggaggatacattctatttaaggaccccctgtcggtaaaccag
ggactcggcatcctatgcacgctcttcggtatcctcacctacacccactttaaactcagc
gagcaggaaggcagtaagagtaagctggtccaacggccctga

DBGET integrated database retrieval system