KEGG   Mus musculus (house mouse): 215445
Entry
215445            CDS       T01002                                 
Symbol
Rab11fip3, Cart1, D030060O14Rik, Rab11-FIP3, mKIAA0665
Name
(RefSeq) RAB11 family interacting protein 3 (class II)
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    215445 (Rab11fip3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    215445 (Rab11fip3)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    215445 (Rab11fip3)
SSDB
Motif
Pfam: RBD-FIP EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_1 WD40_alt EF-hand_5 EF-hand_9 ZapB
Other DBs
NCBI-GeneID: 215445
NCBI-ProteinID: NP_001156340
MGI: 2444431
Ensembl: ENSMUSG00000037098
UniProt: Q8CHD8
Position
17:complement(26208010..26289010)
AA seq 1047 aa
MELCQPTSLSDHDQPASGPQRGVMGLVGPDAPRGWSEEPEEHAQLQRWPEGPNAPICWPE
EVEEPHAPSRWAKEPNAPRCSSQEPDESCHLAEELEESDSPRCWPQEPDTPCHLAKELEE
PDAPRCLPQEPDTPCYLAKELEEPNIPRCWPQEPDVPCHLAKELEEPDAPRCWPQEPDAF
CHLLKEVEEPDALRCWLQGPDAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPC
HLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDALHCWPQESEAPCL
LAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCC
WPEESEEPDALNPPCFWANEPDEPDPSRCWSEEPQVLCLWPEEQNTKRCWQEEPDAPCFW
PEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSD
PGPALSLPSEPGTAQEEGARLRAVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYL
DPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEETPACADEFDDFVTYEANEVTD
SAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALL
LLPGRSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPSPAKRLSS
RKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGR
LRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQ
QLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERH
QFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRR
LKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEE
INFRLQDYIDRIIVAILETNPSILEVK
NT seq 3144 nt   +upstreamnt  +downstreamnt
atggagctgtgccagccgacctccctgtcagaccacgaccagccagcgtctgggccccag
cgtggggtcatggggctggtggggcccgacgctcctcgcggctggtcagaagagcccgag
gaacacgcccagcttcaacggtggccagagggacccaacgcgccaatctgctggcccgag
gaggtagaggagcctcacgctcctagtcgctgggccaaagagcccaatgcccctcgctgc
tcgtcccaggagcccgatgaatcctgtcacttggcagaggagctggaggaatccgactcc
cctcgctgctggccccaggagccagacacaccgtgccacttggccaaggagttggaggaa
cccgacgcccctcgctgcctgccccaggagcccgacacaccgtgctacttggccaaagag
ctagaggaacccaacatccctcggtgctggccccaggagcccgacgtgccgtgccacttg
gccaaggagctagaggaacccgacgcccctcgctgctggccccaggaaccagacgcattc
tgtcacttgctcaaggaggtggaggaacctgatgcccttcgctgctggcttcaagggcca
gacgcaccgtgccacttggccaaggaactggaggacctcgactcccctcgctgctggccc
caggagcccgacgaatcctgtcacttggctaaggagctggaggaaccagacgcaccgtgc
cacttagccaaagagctggaggaacccgacgcccctcgctgctggccccaggagcccgac
gtgccctgtctcttggccaaaaagtgggaggaatccgacgcaccgtgcctcttgacggag
gagctggaagagcctgacgcccttcactgctggccccaggagtcagaggcaccgtgtttg
ttggccaaggagctagaagagcctgatgcctctcacagctgtcctcaggaggcggacaca
gggtgcctctcggccaaggagccagaggagcctgatgtctctcacctgtggcagggggta
cccgatgcaccgtgcctcttggtcaaggaaccagaggaggccgatgcacttcactgttgt
tggcccgaggaatccgaggagccggatgctctcaacccaccgtgtttctgggccaatgaa
ccagacgagcccgatccatcacgatgttggtcagaggagccccaggtgctgtgcctctgg
ccggaggagcagaacacaaagcggtgctggcaggaagagcccgatgcaccctgcttctgg
cccgaggatcgagaggaacccatagtttcgtgtcttcaatttaaagagccagagaagccc
aaagtccggagcagttggcctgaggagctggaagactgctgccctacgcggggcctaccc
cttgagcccttgctcgccgacggcgagctgctgcaggcatgtcccgggccaccctcggac
ccaggaccagcgttgtcgctgcccagcgagcccgggacagctcaggaggagggtgcacgc
ctcagggcggtatttgacgccctggacagagatggggacggcttcgtccgcatcgaggat
ttcatccaattcgccacggtctatggggcagagcaggtgaaggacttaactcagtacctg
gacccgagtgggcttggcgtaatcagctttgaagatttctaccaagggattgtagccatc
agaaatggagatcctgatggccagttgtacagcgtggagcctgtccaagatgaagagacc
cctgcctgtgccgatgagtttgacgactttgtcacctatgaggccaacgaggtgacagac
agtgcatatatggggtctgagagcacctacagtgagtgtgagaccttcacagatgaggac
accagcaccctggtgcaccccgagctgcagcctgaaggggacgtggacagtgctggtggc
tcaggggtgccctctgagtgcctggacaccatggaggagcctgaccatggtgcattgctg
ctgctcccaggcagatcccgcccccacagccaagctgtcgtcatggtgattggcagtgag
gaacattttgaagattatggtgagggcaatgaggcagaactatccccggagaccctctgc
gatggggacggcgaggaccctgcttttctcacccccagcccagccaagcggctctccagc
aggaaggtggcaaggtatctgcaccagtcggggaccctgactatggaggccctggaggac
cctcccccagagcctgtggagtgcccagaggaggacattgcagacaaggtcatcttccta
gagagacgggtgtcagagctggagaaggacagtgcagctgctggcgagcagcatggcagg
ctgaggcaagaaaacctccagctggtgcacagagccaatgccttggaagagcagctgaag
gaacaggagttcagagcccaagagaaggtcctagaagaaaccaggaagcagaaggaactt
ctgtgcaagatggagcgtgagaagagcattgagatcgagaacctgcaggccaggttgcag
cagctggatgaggagaacagtgagctgcggtcctgcacaccctgtctgaaggccaacatc
gagcgccttgaggaggagaagcagaagatgctggatgagattgaggagttgacacagcgg
ctcagtgaggaacaggagaataagaggaaaatgggggacaggctgagccatgagcggcac
caattccagagagacaaggaagcaacccaggagctgatcgaggacctccgcaagcagcta
gaacatctacagctcctcagactggaggtggagcagcgacggggccgcagcagcagcctg
ggcctgcaggagtacaacagccgtgcacgggagagcgagctggagcaggaggtccgcaga
ctcaaacaggacaaccgtaacctgaaggagcaaaatgatgagctaaatgggcagatcatc
accctcagcatccagggtgccaagagcctcttctccacgtctttctcagaatcactggct
gcagaaatcagctctgtctcccgagatgagctcatggaagcaatccagaagcaggaggag
atcaatttccgcctgcaggactacattgacaggatcattgtggccatcctggagaccaac
ccatccatcctagaggtcaagtag

DBGET integrated database retrieval system