KEGG   Mus musculus (mouse): 215446
Entry
215446            CDS       T01002                                 

Gene name
Entpd3, Cd39l, Cd39l3, HB6, NTPDa, NTPDase-3
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 3
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    215446 (Entpd3)
   00240 Pyrimidine metabolism
    215446 (Entpd3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    215446 (Entpd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    215446 (Entpd3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     215446 (Entpd3)
CD molecules [BR:mmu04090]
 Proteins
  215446 (Entpd3)
SSDB
Motif
Pfam: GDA1_CD39 DUF3739
Other DBs
NCBI-GeneID: 215446
NCBI-ProteinID: NP_848791
MGI: 1321386
Ensembl: ENSMUSG00000041608
Vega: OTTMUSG00000025405
UniProt: Q8BFW6
Position
9; 9 F4
AA seq 529 aa
MFTVMTRQPCEQAGFRALSRTPAIVTLVVLLVSIVVLVTLTLIQIRHPQVLPPGLKYGVV
LDAGSSRTTVYVYQWPAEKENNTGVVSQTFRCSVKGSGISSYENNPQDAPKAFEDCILKV
KEQVPEHLHGSTRIYLGATAGMRLLRLQNETAAREVLESIQSYFKSQPFDFRGAQIISGQ
EEGVYGWITANYIMGNFLEKNLWHMWVHPHGVDTTGALDLGGASTQISFVAGEKMEPNAS
DTVQVSLYGYTYTLYTHSFQCYGQNEAEKKFLAMLLQSPSTEANISNPCYPQGYSTAFTL
GHVFGSLCTEKQRPESYNSSKSVTFMGTGDPRLCREKVASVFDFNACQEQDACSFDGIYQ
PKVQGPFVAFAGFYYTASALNLSGSFSLTSFNDSSWDFCRHTWSELPALLSRFDETYARS
YCFSAHYIYHLLVNGYKFTEETWPQIRFEKEVGNSSIAWSLGYMLSLTNQIPAGSPLIHL
PIQPPVFMGVLAFFTAIALLCLAFLLYLCSSFRTKERSENAFDQAVDSD
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtttaccgtgatgacccgccagccatgtgaacaggcaggcttcagggccctctcgagg
actcctgccatcgtcaccttggtggtcctgcttgtgagcattgtggtacttgtgacactt
acactcatccagatccgccacccacaggttctccctccggggctgaagtatggcgtcgtg
ctcgatgctggctcttccagaaccactgtctacgtgtatcagtggccggcagagaaggag
aataacacaggagtggtcagccaaactttcagatgcagtgtgaaaggctctgggatctcc
agctatgagaataacccccaagatgcccccaaagcctttgaggactgtatactaaaggtc
aaggaacaggtcccagagcacctccacggatccacccgcatttacctgggagctacagct
gggatgcgcttgctgaggttgcagaatgagacagcagctcgtgaagtccttgagagcatc
caaagctacttcaagtcccagccttttgattttaggggtgctcaaatcatttctgggcaa
gaggaaggggtgtatggatggattacagccaactatataatgggaaatttcctggagaag
aacctgtggcacatgtgggtgcacccgcacggagtcgacaccacaggagccctggattta
ggtggcgcctccacccagatatccttcgtggccggggagaagatggagccgaacgccagc
gacacggtgcaggtgtctctgtacggctacacgtacactctctacacacacagcttccag
tgctatggccagaatgaagcagagaagaagttcctggccatgcttctacagagcccttcc
acggaagccaacatcagcaacccctgctaccctcagggctacagtaccgccttcaccttg
ggccatgtgtttggcagcctgtgcacagagaagcagaggccagagagctacaactccagt
aagagcgtcaccttcatgggaactggtgacccacgactgtgcagggagaaggtggcttct
gtgtttgacttcaatgcttgccaagagcaagacgcctgttcctttgatggcatttaccag
cccaaggttcaagggccatttgtggcgttcgcaggcttctactacacagccagtgcgcta
aacctctcaggaagcttctcccttacctccttcaatgacagcagctgggacttctgcaga
cacacttggagcgagctcccagccctgctctccagatttgatgagacgtatgcccggtcc
tactgcttctcagcccactacatctaccacttgctcgtaaatggatacaagttcactgag
gagacttggcctcagatacgctttgaaaaagaagtggggaacagcagcatcgcctggtcc
cttggctacatgctcagcttgaccaaccagatcccagctggaagtcccctgatccatcta
cccatacagccaccggtgtttatgggagtcctggccttcttcacagctatcgccttgctg
tgcctggcatttcttctgtatctatgttcatcattcaggacaaaggagcgctctgagaat
gccttcgaccaagcagtggattctgattga

DBGET integrated database retrieval system