KEGG   Mus musculus (mouse): 215494Help
Entry
215494            CDS       T01002                                 

Gene name
Pomgnt2, Ago61, C85492, Gtdc2
Definition
(RefSeq) protein O-linked mannose beta 1,4-N-acetylglucosaminyltransferase 2
  KO
K18207  protein O-mannose beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.312]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00515  Mannose type O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    215494 (Pomgnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    215494 (Pomgnt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.312  protein O-mannose beta-1,4-N-acetylglucosaminyltransferase
     215494 (Pomgnt2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   215494 (Pomgnt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-GeneID: 215494
NCBI-ProteinID: NP_001276487
MGI: 2143424
Ensembl: ENSMUSG00000066235
Vega: OTTMUSG00000062705
UniProt: Q8BW41
Position
9; 9 F4
AA seq 580 aa AA seqDB search
MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALGQQSLDPVLGLKIDYPKALQIL
MEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNSSVMLPNLGSRRFQPALLDLS
TVEDHNAQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLR
QFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKVT
TWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAGAPLGEEYILVFSRTQNRLI
LNEAELLLELAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLVTALFLPRGAT
VVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRNMIRENTVTHPERPWDQGGITHLDRA
EQARILQSREVPRHLCCRNPEWLFRIYQDTRVDIPSLMQSIRRVVKGRPGPRRQRWAISL
YPGKVREARCQASVQGATEARLSVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYMLT
LQNHTFTENIKPFTTYLVWVRCIFNRSLLGPFADVLVCST
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcacctctctgccgtattcaacgccctcctggtatcagtgctggctgcggtcctgtgg
aagcatgttcggttgcgggagcatgcggccacgctagaggaggagctggcccttggacag
cagtccctggatccagtcctaggactgaagatcgactacccgaaggccctgcagatcctc
atggagggcggcacccacatggtgtgcacaggccgcacccacacggaccgcatctgccgc
ttcaagtggctctgctactccaatgaggccgaagaattcatctttttccatggcaactca
tctgtgatgctgcccaacctgggctcccggcgcttccagccggccctgctggacctgtcc
actgtggaggaccataatgcccagtacttcaacttcgtggagctgcccgctgcagccctg
cgcttcatgccaaagccagtgttcgtgcctgatgtagccctcatcgccaaccgcttcaac
cccgataacctcatgcacgtctttcatgatgacctgctcccactcttctacacactgagg
cagttccccggcctggcccaagaggcccggctctttttcatggagggatggggtgagggt
gcccactttgacctctataaactcctcagccccaagcagccgcttctacgtgcacagctc
aagacactgggccgactgctctgcttttcccatgctttcgtgggcctgtccaaggttacc
acctggtaccaatacggctttgtacagccccagggcccaaaagccaacatcctggtctct
ggcaatgagatccggcagttcacgcgcttcatgactgaaaggctgaacgtgagccacgcg
ggggcgcccctgggggaggaatacattctggtcttcagtcgcacccagaacagactcatc
ctgaacgaggcagagctgttgctggagctggcacaagagttccagatgaagacggttaca
gtgtccctggaggaccacacctttgctgatgtcgtgcggctggtcagcaatgcctccatg
ttggtcagcatgcatggggcccagctggttacggccctcttcctgccccgcggggctacc
gtggttgaactcttcccttacgctgtcaatcctgaccactacaccccctataagacgctg
gccacactgcctggcatggacctgcagtatgtagcctggcgaaacatgatccgggagaac
acagtcacacaccctgagcgaccgtgggaccaagggggcatcacccacctggaccgggct
gagcaggcccgtatcctgcagagccgagaggtcccccggcatctctgttgccggaaccca
gagtggctattccgaatctaccaggacaccagggtggacatcccatcccttatgcaatcc
attcggcgtgtggtgaagggccggccggggccacggaggcagaggtgggcaatcagcctg
tacccgggcaaggtgcgggaggctcgatgtcaggcgtcagtgcagggtgccaccgaggcc
cgcctgtctgtgtcctggcagatcccgtggaacctcaagtacctgaaagtgagggaggtg
aaatacgaggtgtggctgcaggagcaaggggagaacacgtatgtgccttacatgctgacc
ctgcagaaccacaccttcacagagaacatcaaaccttttaccacctacctggtgtgggtc
cgctgtatatttaacaggagcctcctgggaccttttgcagatgtgctggtgtgcagcacg
tag

DBGET integrated database retrieval system