KEGG   Mus musculus (house mouse): 215512
Entry
215512            CDS       T01002                                 
Symbol
Fam117a, 5730593F17Rik, AW548096
Name
(RefSeq) family with sequence similarity 117, member A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM117
Other DBs
NCBI-GeneID: 215512
NCBI-ProteinID: NP_766131
MGI: 2144564
Ensembl: ENSMUSG00000038893
UniProt: Q7TNF9
Position
11:95227844..95272698
AA seq 451 aa
MSGAAAGGRGGGSWGPGRGGAGGLRRGCSPPAPAGSPRVGLQPLRATVPFQLQQPHQRRD
GGGRAASVPCSVAPEKSVCRPQPPQVRRTFSLDTILSSYLLGQWPRDADGAFTCCTNDKA
TQTPLSWQEPEGERASFCMHKRSASWGSTDHRKEITKLKQQLQRTKLSRSGKEKERSCPV
QGDHAALGAGRASLPSHPPGPPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEV
PDGHRAPAPPQNSSCDHSLLLEPGNLTSSPSVPLASPQPPSQASREEHQGATEELASIHG
NKASSPGNPAFLEDGSPSPVLAFAASPRPNHSYVFKREPPEGCERVRVFEEATSPGPDLA
FLTSCPDKNKVHFNPTGSAFCPVSLIKPLFPSMGFIFRNCPSSPGSPLPTASPRAPRKGP
EASKASSLPSEPWQRSPPSEESVLFQSSLVV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtccggggccgcagcgggcggccgaggcggaggttcctgggggccggggcgcggaggg
gcggggggtctccggcggggctgctctccaccggcgcccgctggctccccccgggtcggt
ctgcagccactcagggctacggtccccttccagctgcagcagcctcaccagcgccgggac
gggggtggccgcgcagccagcgttccatgttcggtggccccagaaaagtcggtgtgtagg
cctcagccaccccaggtccggcgtacgttctccctggacaccatcctcagttcctacctt
ctgggccagtggccacgagatgccgatggggccttcacctgctgtaccaatgacaaggcc
acccagacacccctgtcctggcaagaaccagaaggtgagcgggccagcttctgcatgcac
aagcggtcagcatcgtggggcagcacagaccaccgaaaagagatcaccaagttgaagcag
cagctgcagaggacaaaactgagccgcagtgggaaggagaaggagcggagctgccctgtc
caaggggaccatgctgcgctgggagcagggagggcatcccttcccagccaccccccagga
ccccccgtcctgcgactcagcccttgtctgcacagaagcctagaagggctcaaccaggag
ctggaagaggtgtttgtgaaggagcagggtgaagaggagctgctgaggatacttgaggtc
cctgatgggcaccgtgccccagctcctccacagaatagcagctgtgaccattccctcctt
ttggagccaggcaacctgaccagctctccctccgtgccactggcatccccccagcctccc
agccaggccagccgtgaggagcaccagggtgccaccgaggaactagcatccatccacggt
aacaaagcctcctctccaggcaacccagccttcctagaagatggcagtccgtctccagtc
cttgcctttgctgcttcccctcggcccaatcacagctacgtcttcaaacgggagccccca
gaaggctgtgagagagtgcgtgtgtttgaggaggccacgtccccaggtcctgacttggcc
ttcttgacttcctgtcctgacaagaacaaagtccatttcaacccgactggctccgccttc
tgccctgtcagcttgatcaagcccctcttccccagtatgggcttcatcttccgtaactgc
ccctccagccctggctcccctcttcccactgccagccccagggcacctcggaagggtcca
gaagcttccaaggcctcctcgctgccatctgagccatggcagcgcagcccaccatcggaa
gagtctgtgcttttccagagctccttggtagtctga

DBGET integrated database retrieval system