KEGG   Mus musculus (house mouse): 215693
Entry
215693            CDS       T01002                                 
Symbol
Zmat1, A230096A06, AW990744, B930008K04Rik
Name
(RefSeq) zinc finger, matrin type 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-met zf-C2H2_4 zf-CCHC_2
Other DBs
NCBI-GeneID: 215693
NCBI-ProteinID: NP_780655
MGI: 2442284
Ensembl: ENSMUSG00000052676
UniProt: G5E8E4
Position
X:complement(133872121..133909958)
AA seq 647 aa
MAAAGRGDSSFKVDTCPCLREDPTCDGQEQPAYFTDNFCKPCGVVLQHESERISHFESEI
HAQNVKFFFQMHGEQSEVPGRKVNMHAGNSQVCSSGEVNRNNFTDLHNMSFDSLAAAPSH
YVGKSHSPTQNQSLEEHDQVSPSTCSPKMDEPNTTPAPPPFLKSVIVKPPPAYRMRTYVC
HICSITFTSLHMFRSHMQGTEHQIKESHVINQVKNSKKMQESCQAECGDDIKMKKSRELE
PKGHFREMEDNYMEAQAHEYREMVDSRPRHKMLEQTLPLENFWAHPGPYNDSRALEEQLP
HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYRERVDSEHRQR
PCEERFSFEAPQTYQQEYSASPVEGQSPHWLPSHSKRRNDDFQNEFDDYNKVQESRESEP
KTSFRRMDSSFETHNYEEMVDRRSSHTMFEEGLPCETFQTYTDPYSSAQAVENTLPHCLP
AYENQPSLDAESHYQLTTEEFSEMPASLSLSQQEDNPSSYNVDYDIYKHLPSNDNASAHE
TSHRRRRQKRKRHLEEGKERPEKEQSKHKRKRSYQDKDLDKDKLIKQSKREEDKAGVSSE
KTKHRRKKRKHETSSEKEERKHKKEKKKSVEERTEEEILWDESILGF
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggcggcggcggggaggggggacagtagttttaaagtagacacctgcccttgcctcaga
gaagatcccacgtgtgatggacaagaacaacctgcgtattttacagataatttttgtaaa
ccatgtggagtggttctacagcatgaatcagaaaggatttcacattttgagagtgaaata
catgctcaaaatgttaagttcttttttcaaatgcatggagaacaaagcgaagtgcctggt
aggaaagtgaacatgcatgctggaaattctcaggtgtgctcgagtggagaagtcaacaga
aacaactttactgatctgcacaacatgagttttgactccctagctgctgctccatctcac
tatgtgggaaagagccattctccgactcagaaccagtcactggaagaacatgatcaagta
tctccatccacatgctcaccaaagatggatgaacccaatactactcctgcacctccaccc
ttcctgaagtctgttattgtgaagcctcctccagcatatagaatgagaacctacgtatgc
catatctgcagtatcacctttacatctttacatatgttccggtcccacatgcaaggaact
gaacatcaaattaaagaatctcatgttatcaatcaagtgaagaattcaaagaaaatgcaa
gagtcttgtcaagctgagtgtggagatgacatcaaaatgaagaaatctagagaactagag
cccaagggtcatttcagggaaatggaggataattacatggaagcccaagcccatgaatac
agagaaatggttgattctagacccagacataaaatgcttgaacaaacacttccacttgaa
aatttctgggcacacccaggaccatacaatgattctagagcactagaagagcagttacct
cacaatttaccagcagagtcaaagacatatgactctttccaagatgaacttgaagattac
atcaaagggcagaaggccagaggacttgatcccaatactagttttagacggatgtcagaa
agctataggtatagggatcagagatacagagaaagggttgattctgaacacagacagagg
ccttgtgaggaaagattttcatttgaggctccacagacctaccagcaagaatacagtgcc
tccccagtggagggccaatctcctcactggttaccatctcattcaaagaggagaaatgat
gatttccaaaatgaatttgatgattacaacaaggtgcaggaatctagagaatccgagcca
aagacttcttttagaagaatggatagctcttttgaaacccataattacgaagaaatggtt
gacagaagatccagtcatacaatgtttgaggaaggactcccatgtgagactttccagact
tacacagatccatacagcagtgcacaagcagtagaaaacacgttacctcattgcttacca
gcttatgaaaaccaaccgagcctagatgctgaaagccactatcagcttaccacagaggag
ttctcagaaatgcctgcttctctgagcctcagtcaacaagaagataaccctagctcatac
aatgtagactatgacatttacaagcatctgccctcaaatgacaatgccagtgcccatgaa
acaagtcatagaaggcgacgtcagaagagaaaacgacacctggaggaaggaaaagaaaga
ccagagaaggaacagtccaaacataaaagaaaaagaagctatcaggataaagatttagac
aaagacaagctcatcaagcaaagtaagagagaggaagataaagctggagtcagctctgaa
aaaaccaagcatcgaagaaagaaaagaaaacatgaaacatcctcagagaaagaagaacgt
aagcacaaaaaagagaaaaagaaatctgttgaagagagaacagaagaggaaatcctttgg
gatgagtcaattcttgggttctga

DBGET integrated database retrieval system