KEGG   Mus musculus (house mouse): 215708
Entry
215708            CDS       T01002                                 
Symbol
Miga1, A930038D06, C030011O14Rik, Fam73a, Mita1
Name
(RefSeq) mitoguardin 1
  KO
K27289  mitoguardin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    215708 (Miga1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    215708 (Miga1)
SSDB
Motif
Pfam: Miga
Other DBs
NCBI-GeneID: 215708
NCBI-ProteinID: NP_777357
MGI: 1924567
Ensembl: ENSMUSG00000054942
UniProt: Q4QQM5 B2RRB9
Position
3:complement(151979096..152046073)
AA seq 600 aa
MSDETVSRSQFSLKTYAVRVFALPVSWYYSLSQIKFSPVAKKLFMVTAVSAVSVIFLAHH
FKRRRGKQKGKVLPWEPEHLLLEHTRRAASEKGSSCSSSRQNLTLSLSSTKEKGSQCCNY
PNGGLLSRYSGSAQSLGSVQSVNSCHSCACGNSNSWDKADDDDIRLVNIPVTTPENLYLM
GMELFEEALRRWEQALTFRSRQAEDEACSSVKLGAGDAIAEESVDDIISSEFIHKLEALL
QRAYRLQEEFEATLGGSDPNSIANDTDKDTDMSLRETMDELGLPDAMNMDSADLFASATE
LAEQREAQQTFSLESFCPCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIR
QAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTEL
ELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSV
LKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFD
FEKVRYSSIDTLAEDLTHLLIRRTELLVTCLGADALRHATTCTSGHSHAVPTALLEAKVQ
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtcagacgagacagtcagcagatcacagttctccttgaagacgtacgcagttagagtg
tttgctctccctgtgtcttggtattattctctctcccagatcaaattttcaccagtagct
aagaagctgttcatggtaactgccgtgagtgctgtgtctgtgatttttctggcccatcac
tttaaaagaagacggggaaaacagaagggcaaagtgctgccctgggaacccgagcacctc
ctccttgagcacactaggagagctgcatcagaaaaaggttcgagttgctccagcagtcgg
cagaatctgaccttgtcgttaagctccaccaaggagaaaggatctcagtgttgcaactac
ccgaatggagggcttctcagcagatactcgggctctgcccagagcctgggctccgtccag
agtgttaactcctgtcatagttgtgcttgtggaaattctaattcctgggacaaagcagac
gatgatgacatcagacttgttaacattcctgtgaccacacctgagaacttatacctgatg
ggtatggaattatttgaagaggcgttacgacgatgggaacaagctctgacttttcgaagt
agacaggctgaagatgaagcctgcagctctgttaaactgggagccggagatgccattgca
gaagaaagtgtggatgatattattagttcagaattcatccataaacttgaagctctactg
caaagagcgtatcgtctccaagaggagtttgaggctacccttgggggatctgaccctaat
tccattgcaaatgatactgataaagacacagacatgagcttgagggagactatggatgag
cttggcctgccagacgccatgaacatggactcagcagatctctttgcttcagcaacagag
ctcgcagagcagagagaagcgcagcagaccttcagcctggagtctttttgtccctgccct
ttctacgaagaagctatgcatttagttgaagaaggaaaaatttactccagagtgctgaga
acggagatgctggagtgcctgggagacagtgacttcctcgccaaacttcactgtatccgg
caggcttttcagctaatccttgcagaagcagacaacaggtcattccttgctgaaagtgga
aggaaaattttgtcagctttaattgtgaaagcacggaagaatccaaagaaatttcaagat
gtttttgatgaaatgatcaattttttagagcagactgatcactgggatagcactgagctg
gaacttgctgccagaggggtgaaaaatttaaatttttatgacgtggttctggattttata
ttaatggattcctttgaagatttagaaaacccaccgacatccatacagagcgtagtgaac
aatcgctggctcaactcttccttcaaagaaagcgctgtggcttcaagttgttggtcagtg
ctgaaacagaaaaggcaacagatgaagatctcagatggatttttcgctcatttttatgcc
atttgtgagcatgtcagccctgttttagcctggggcttcttgggtcctagaaattctctc
tatgacttatgttgcttctttaagaatcaagttcttttctttctcaaagacatcttcgac
tttgagaaggtgcgctattcgagcatagacacgctggcggaggacctcacgcacctactc
atccgccgcacggagctgctggtcacctgtcttggtgcagatgccctgaggcacgccacc
acttgcacgagtggacactcccacgccgtgcccactgcgctcttagaagccaaagtacaa
taa

DBGET integrated database retrieval system