KEGG   Mus musculus (mouse): 215708Help
Entry
215708            CDS       T01002                                 

Gene name
Miga1, A930038D06, AI852168, C030011O14Rik, Fam73a, Mita1
Definition
(RefSeq) mitoguardin 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Miga
Motif
Other DBs
NCBI-GeneID: 215708
NCBI-ProteinID: NP_777357
MGI: 1924567
Ensembl: ENSMUSG00000054942
Vega: OTTMUSG00000053787
UniProt: Q4QQM5 B2RRB9
Position
3; 3 H3
AA seq 600 aa AA seqDB search
MSDETVSRSQFSLKTYAVRVFALPVSWYYSLSQIKFSPVAKKLFMVTAVSAVSVIFLAHH
FKRRRGKQKGKVLPWEPEHLLLEHTRRAASEKGSSCSSSRQNLTLSLSSTKEKGSQCCNY
PNGGLLSRYSGSAQSLGSVQSVNSCHSCACGNSNSWDKADDDDIRLVNIPVTTPENLYLM
GMELFEEALRRWEQALTFRSRQAEDEACSSVKLGAGDAIAEESVDDIISSEFIHKLEALL
QRAYRLQEEFEATLGGSDPNSIANDTDKDTDMSLRETMDELGLPDAMNMDSADLFASATE
LAEQREAQQTFSLESFCPCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIR
QAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTEL
ELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSV
LKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFD
FEKVRYSSIDTLAEDLTHLLIRRTELLVTCLGADALRHATTCTSGHSHAVPTALLEAKVQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgagacagtcagcagatcacagttctccttgaagacgtacgcagttagagtg
tttgctctccctgtgtcttggtattattctctctcccagatcaaattttcaccagtagct
aagaagctgttcatggtaactgccgtgagtgctgtgtctgtgatttttctggcccatcac
tttaaaagaagacggggaaaacagaagggcaaagtgctgccctgggaacccgagcacctc
ctccttgagcacactaggagagctgcatcagaaaaaggttcgagttgctccagcagtcgg
cagaatctgaccttgtcgttaagctccaccaaggagaaaggatctcagtgttgcaactac
ccgaatggagggcttctcagcagatactcgggctctgcccagagcctgggctccgtccag
agtgttaactcctgtcatagttgtgcttgtggaaattctaattcctgggacaaagcagac
gatgatgacatcagacttgttaacattcctgtgaccacacctgagaacttatacctgatg
ggtatggaattatttgaagaggcgttacgacgatgggaacaagctctgacttttcgaagt
agacaggctgaagatgaagcctgcagctctgttaaactgggagccggagatgccattgca
gaagaaagtgtggatgatattattagttcagaattcatccataaacttgaagctctactg
caaagagcgtatcgtctccaagaggagtttgaggctacccttgggggatctgaccctaat
tccattgcaaatgatactgataaagacacagacatgagcttgagggagactatggatgag
cttggcctgccagacgccatgaacatggactcagcagatctctttgcttcagcaacagag
ctcgcagagcagagagaagcgcagcagaccttcagcctggagtctttttgtccctgccct
ttctacgaagaagctatgcatttagttgaagaaggaaaaatttactccagagtgctgaga
acggagatgctggagtgcctgggagacagtgacttcctcgccaaacttcactgtatccgg
caggcttttcagctaatccttgcagaagcagacaacaggtcattccttgctgaaagtgga
aggaaaattttgtcagctttaattgtgaaagcacggaagaatccaaagaaatttcaagat
gtttttgatgaaatgatcaattttttagagcagactgatcactgggatagcactgagctg
gaacttgctgccagaggggtgaaaaatttaaatttttatgacgtggttctggattttata
ttaatggattcctttgaagatttagaaaacccaccgacatccatacagagcgtagtgaac
aatcgctggctcaactcttccttcaaagaaagcgctgtggcttcaagttgttggtcagtg
ctgaaacagaaaaggcaacagatgaagatctcagatggatttttcgctcatttttatgcc
atttgtgagcatgtcagccctgttttagcctggggcttcttgggtcctagaaattctctc
tatgacttatgttgcttctttaagaatcaagttcttttctttctcaaagacatcttcgac
tttgagaaggtgcgctattcgagcatagacacgctggcggaggacctcacgcacctactc
atccgccgcacggagctgctggtcacctgtcttggtgcagatgccctgaggcacgccacc
acttgcacgagtggacactcccacgccgtgcccactgcgctcttagaagccaaagtacaa
taa

DBGET integrated database retrieval system